(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE56

AE017197.PE56        Location/Qualifiers
FT   CDS_pept        complement(79064..79882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03546"
FT                   /db_xref="GOA:Q68XU6"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XU6"
FT                   /protein_id="AAU03546.1"
FT                   /translation="MPLSTSLLGKKSTYKDSYDATLLFKIPRINNRNVLGINNNLPFYG
FT                   VDIWNTYEISCLNKNGKPLVGIGTFYIPADSENIVESKSFKLYLNSFNNFIVKSIEELE
FT                   QIILQDLSNVTCAKVTGRIFPINTKIEFGIPSGKNIDNLDIVCNNYGPPDNSLIEYEDV
FT                   LVEEEIHSNLLKSNCLVTGQPDWGTIVIKYKGKKLKYDSFLRYLISFRNCNEFAEQCAE
FT                   RIFIDIKNAINLDFLSIYIVYTRRGGIDICPYRSTDKSYALPSNKRFIRQ"
     atgcctttat ccacttcttt actcggtaaa aaaagtactt ataaagatag ttatgatgca        60
     actttattat ttaaaattcc acgtataaat aataggaatg tacttggaat aaataataat       120
     cttccgtttt acggtgtaga tatttggaat acatatgaga tatcttgtct taataagaat       180
     ggaaaaccat tggttggaat agggactttt tatataccag cggattccga aaatatagta       240
     gaatcaaaat catttaaatt atatctcaat tcttttaata actttattgt taaatcaata       300
     gaagaattag aacaaattat attgcaggat ctaagtaatg ttacatgcgc taaagtaaca       360
     ggacgaatat tccctataaa taccaaaata gaatttggta ttccaagtgg gaaaaatata       420
     gataatttag atatagtgtg taataattac ggtccaccag ataatagttt aattgagtat       480
     gaagatgttt tagtagaaga agagattcat tctaatttac ttaaatcaaa ttgcttagta       540
     accggacaac cagattgggg tacaatagtt ataaaatata aaggaaaaaa gttaaaatat       600
     gattcttttc taaggtatct catatctttt agaaattgta acgagtttgc agaacagtgt       660
     gctgagcgta tttttataga tataaaaaat gctataaatc ttgattttct ttctatttat       720
     atagtatata ctaggcgtgg aggaattgat atttgtcctt atcgttctac agataaaagt       780
     tatgctttac ctagcaataa gcgatttatt agacaataa                              819
//

If you have problems or comments...

PBIL Back to PBIL home page