(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE562

AE017197.PE562       Location/Qualifiers
FT   CDS_pept        complement(761803..762075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0587"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04052"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WE0"
FT                   /protein_id="AAU04052.1"
FT                   /translation="MNKLNKNALQKKLFYRSKKRGCREMDYILGSFAEKYLSFMDEKTL
FT                   KRYTLILDQNDNDLYNWINNKSSAPSYIDSEIIDKLSKIAQIKLL"
     atgaataaat taaataaaaa cgctttacaa aagaaacttt tttatcgtag taaaaagcgt        60
     ggttgcagag aaatggatta tatacttggt agttttgctg aaaagtactt atctttcatg       120
     gatgaaaaga cacttaaaag gtatacttta atacttgatc aaaatgataa tgatctttat       180
     aattggatta ataataaatc ttctgcgcct tcttatatag attccgaaat aattgacaaa       240
     ttaagcaaaa tagcacaaat aaagctcctg tag                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page