(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE576

AE017197.PE576       Location/Qualifiers
FT   CDS_pept        complement(778825..778974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04066"
FT                   /db_xref="GOA:Q68WC6"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WC6"
FT                   /protein_id="AAU04066.1"
FT                   /translation="MHYLGYGGLSLGTILAIVISFNVNKSILWAIIHGFCGWFYVVYYL
FT                   LLKK"
     atgcattact taggatatgg tggtctttct cttggtacaa tacttgcaat agtaatatca        60
     tttaatgtga ataaatcaat attatgggct ataattcatg ggttttgtgg ttggttttat       120
     gttgtatatt atttgttatt gaaaaaataa                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page