(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE596

AE017197.PE596       Location/Qualifiers
FT   CDS_pept        812539..813204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0622"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04086"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WA6"
FT                   /protein_id="AAU04086.1"
FT                   /translation="MQQYIFRFTTSNKYHPDEFIVSSSNAQAYNIIKNWQCCFGVNPYK
FT                   FTLLIKGPSSSGKTYLTKIWQNLSNAYIIKDIFLNEEILEKNNTFIIEDIESWQEPALL
FT                   HIFNIINEKQKYLLLTSSDKNDNFTLPDLSSRIKSVLSILLNSPDDELIKILIFKHFSI
FT                   SSVTISRQIIDLLLVNLPREYSKIIEILENINYFALISKRKITISLVKEVLNNYKNKI"
     gtgcagcaat atatatttcg ttttactact tctaataaat atcatcctga tgaatttatc        60
     gtgtctagtt ctaatgctca agcttataat attataaaaa attggcagtg ttgctttggc       120
     gtaaatcctt ataaatttac tttattaatt aaaggacctt cttcatcagg taaaacttat       180
     ttaaccaaaa tctggcaaaa tttaagcaat gcatatatta ttaaagatat ttttttaaat       240
     gaagaaattc tagaaaagaa taatactttt attattgaag acattgaaag ctggcaagaa       300
     ccagcattgc ttcacatatt taatattatt aatgaaaaac aaaaatatct tttacttacc       360
     tcatcagata aaaatgataa ttttacttta ccagatttat cttcacgtat caaatcagta       420
     ctgagtattt tattaaattc acctgacgat gaattaatta aaatcttaat atttaagcat       480
     ttttccattt cttcagtaac aatatcaaga caaataatag atttgctttt agtaaatttg       540
     cctagggaat attctaaaat catagaaata ttagaaaata ttaactattt tgctttaatt       600
     tctaaaagaa aaataacaat ttcattagta aaagaagttt taaataacta taagaacaaa       660
     atatga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page