(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE597

AE017197.PE597       Location/Qualifiers
FT   CDS_pept        complement(813926..814159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0623"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04087"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WA5"
FT                   /protein_id="AAU04087.1"
FT                   /translation="MSNTSKLENHYNKLLKDIMLKTLEQNKTVETYLIQQDFSSALDEL
FT                   QQINEKLAEYCKVFTLLEIIKTELDEEDKVYN"
     atgtccaata catctaagtt agaaaatcat tataataagt tgttaaaaga tatcatgctt        60
     aaaacattag agcagaataa aactgtagaa acctatttaa tacaacaaga ttttagtagt       120
     gctttagatg aactccaaca aataaacgaa aagcttgcag aatattgtaa agtttttaca       180
     ttgcttgaaa tcattaaaac tgaactagat gaagaagata aagtatataa ctaa             234
//

If you have problems or comments...

PBIL Back to PBIL home page