(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE60

AE017197.PE60        Location/Qualifiers
FT   CDS_pept        82266..83588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0064"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03550"
FT                   /db_xref="GOA:Q68XU2"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XU2"
FT                   /protein_id="AAU03550.1"
FT                   /translation="MKKLLLAASIIYFASVSLAEEKTTPFISNSDTKIKLEGFYLFESG
FT                   YIKQDHLILFDKNVTDNRKKLGFDTEVAFAATITKTIDDVIAGAKIVLQPTTKAKTTAS
FT                   YNGSHIFIETSYGKVELGSPVDASAQLRVTGNKVTAGTGGWYRYALLDGQYMRYNALKP
FT                   DFDTSVNFYLESYSNSFDQVNEKTEKARRLNFFTPKMKGFQAGISYTPDTANTGGNKNI
FT                   NNLTLQSSGRNGISASRTGIKTLSIANGEIMTINQNIRDAFSAGLTYEHAISEDADLKL
FT                   SMTGEYGKPARRLIHAKVDGTTKAIEVLNTYKLSNLKAYNLGAVFTYGNFSCGASYGNL
FT                   GKSLTAKEYYKVGRNTYYYNGAVAYGQGPIKTSLAYLKTSRYKNTVNAVSLATEYKIMP
FT                   GLLPYAEISHFQAKGKPVYYPEAPSKTTRGTVGLIGTKLKF"
     gtgaaaaaat tattattagc tgcaagtatt atatattttg catcagtcag tcttgccgaa        60
     gaaaagacaa caccttttat ttctaactct gacactaaaa tcaaattaga aggattttat       120
     ctatttgaaa gtggttatat taaacaggat catttaattt tatttgataa aaatgtaact       180
     gataacagaa aaaagctcgg atttgacaca gaagtagcat ttgctgcaac tattactaaa       240
     actatcgatg atgtaatagc aggtgctaaa atagtacttc aaccaactac aaaagcaaaa       300
     accactgcaa gttataatgg gtcccatatt tttattgaaa ctagttatgg taaagtagaa       360
     ttaggctctc ctgttgatgc aagtgcgcaa ttacgtgtta ccggtaataa agtaactgca       420
     ggtactggag ggtggtatag gtatgctcta ctggacggtc agtatatgag atataatgct       480
     ttaaaaccag atttcgatac tagtgttaac ttttatcttg aatcatactc gaattctttt       540
     gatcaagtca atgaaaaaac tgagaaagct agaagattaa acttttttac acctaaaatg       600
     aaaggttttc aagcaggtat ctcttatact cctgatactg ctaatactgg tggtaataaa       660
     aacataaata atttaacact tcaaagctca ggaagaaacg ggataagtgc ttcgagaact       720
     ggcataaaga cattgtccat agcaaacggt gaaattatga ctataaatca aaatattagg       780
     gatgcatttt ctgctggctt aacttatgaa catgcaatta gtgaagatgc agacttaaaa       840
     ttatcaatga ctggagaata tggcaaacct gctcgtcgtc ttattcatgc taaagttgat       900
     ggaacaacta aggcaataga agtattgaat acatataagc tgtctaattt aaaagcatat       960
     aatcttggag ctgtatttac ttacggtaat ttctcgtgtg gggcttctta tggtaattta      1020
     ggtaaaagct taaccgccaa ggaatattat aaagttggac gtaataccta ttattacaat      1080
     ggagcagttg cttatggaca aggacctata aaaacaagtc ttgcttatct caaaacttca      1140
     agatataaaa acaccgtaaa tgctgtaagc ttagctaccg aatataaaat tatgcctggt      1200
     ttattaccgt atgctgaaat ttcacatttc caagctaaag gtaagcctgt atattatcct      1260
     gaagcaccta gtaaaacaac aagaggtact gttggtctta taggtacaaa acttaagttt      1320
     taa                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page