(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE67

AE017197.PE67        Location/Qualifiers
FT   CDS_pept        complement(93161..93472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0071"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03557"
FT                   /db_xref="GOA:Q68XT5"
FT                   /db_xref="InterPro:IPR022718"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XT5"
FT                   /protein_id="AAU03557.1"
FT                   /translation="MSLTQILLSLFVVILVIKPHDLFLIIKKFKTIKAFVIRSFFINTI
FT                   DESLETEQINFYLKRIINLEGYYYGNYDLTTIKEKYYTLIVNNAFIEKESVHDIIEKH"
     atgtctttaa cacaaatatt attaagttta tttgtagtga tattggtaat aaaaccacat        60
     gatctttttt taattattaa aaaatttaaa acaataaaag cgtttgttat taggtcattt       120
     tttataaata caatagatga atcattagaa acagaacaaa taaattttta tttaaaaaga       180
     attattaact tagagggtta ttattatggt aattatgatt taacaacaat aaaagaaaaa       240
     tattatacgc taatagttaa caatgccttc atagagaagg aatcagtaca tgatataata       300
     gagaaacact aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page