(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE79

AE017197.PE79        Location/Qualifiers
FT   CDS_pept        complement(108196..109362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0083"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03569"
FT                   /db_xref="GOA:Q68XS3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XS3"
FT                   /protein_id="AAU03569.1"
FT                   /translation="MQYLMDLYHTSSTELVLLLVMLASLMPVIFLIKRLIFIPIKNYLT
FT                   RHHYDDSERILKKYPIFRYLLHTLLAFYFLCWSNIFHPTSFKAHVLLGIKDTVVILYTS
FT                   ISVTMLLLTLIDAFADLYHNKIKNITKNAPLSLYFQILKIIVIVIAVIITISYILNISL
FT                   SKFLTSLGAAAALLTFVFKDTVLGLLASLQLTTQKIINIGDLVRVGEIEGIVEKITISV
FT                   VTIRNSDQSISTVPTYSLLNSNVTNYRGITESGARRIKRVFNINMATINFCDTTLLKEL
FT                   KKSPYISKDVIDKITLDKEEQDLTNIKLFKLYIQEYLKNNPKVYTEGFTFLVRQLEPTI
FT                   TGLPIEIYIFVKEMNLVNYEHIQDNISEHLISILPEFKLKIFQNVGVV"
     atgcaatatt taatggatct atatcatacc tcaagtactg aattagtatt attgcttgtt        60
     atgttagcat ctcttatgcc agtgatattt ctaattaaaa gattaatttt tattcctata       120
     aaaaattatt taacgagaca tcattacgat gattctgaaa ggatactaaa aaaatatcca       180
     atatttcgtt atttattaca tactttatta gcattttact ttttatgttg gagcaatatt       240
     tttcatccta cttcttttaa agcgcatgta ttacttggaa tcaaagatac cgtagtaatc       300
     ttatatacta gtatatctgt aacgatgtta ttattaacgc ttatagatgc ttttgcagat       360
     ttatatcata ataagatcaa gaacattacc aaaaatgcac cacttagttt atattttcaa       420
     atattaaaaa ttattgtcat agttatcgca gtaattataa ctatttcata tatattaaat       480
     atatcgctga gtaaattctt aacaagttta ggtgcagccg cagctctgtt aacatttgtt       540
     ttcaaagata ccgttttagg attacttgca agtttgcaac taactactca aaaaattatt       600
     aatattggag acttagtacg tgtaggtgaa attgaaggga tagttgaaaa aattactatt       660
     tctgtagtaa caattaggaa ttctgatcaa tctatttcta cagttcctac ttatagcctt       720
     ttaaattcta atgtaactaa ttatagagga attactgaat caggcgcaag aagaataaag       780
     agagtattca atattaatat ggcaactatt aatttctgtg atactactct tttaaaagaa       840
     ctaaaaaaat ctccttatat atcaaaggat gtaatagata aaattactct tgataaagaa       900
     gagcaagatt taactaatat taaactattc aaattatata ttcaagaata tctaaaaaac       960
     aatccaaaag tttatactga aggttttact tttctagtaa gacaacttga acctaccatc      1020
     actggtctac ctatagaaat atatatcttc gttaaagaaa tgaatttagt aaattatgag      1080
     catatacagg acaatatttc cgaacattta atttctatac tccctgaatt taaattaaaa      1140
     atatttcaga atgtaggagt agtataa                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page