(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE92

AE017197.PE92        Location/Qualifiers
FT   CDS_pept        126476..127798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0096"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03582"
FT                   /db_xref="InterPro:IPR020183"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XR0"
FT                   /protein_id="AAU03582.1"
FT                   /translation="MTSIYHILDRIPAIYKQDMEIEYEYLAMQLIKSGKLRIDTNDCCN
FT                   FARFTDPALNISLMVSNEELTRPHLIPETTKLFQSLYKNSASDQKINSIFDNLKKQIQK
FT                   LQPVKQEVTEMLARLFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDIVSWQRVGGNS
FT                   GMQSTNGKDIAIFVSCGGNPFAENNKAHPSYGDGFAAVARLQIIAAQELGHFADIKRDD
FT                   KGRQLTRHAANFSCTKATDKVRLARKSDIIHCNNLFNKLLKAGMKKQLEYETKLKFYNT
FT                   NKISGLKVNAIKFMILIYKFRLLSYSSKNNLIFIRKFKTDKYMALMIETMFKDMQANLS
FT                   PNAEVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKEIMHHLYKIYYNEVIPSLIT
FT                   SYNSFTGENYKRDFKKNKSSFFSKINIFNNKKLILKPVREL"
     atgactagta tatatcacat ccttgaccgt attcctgcta tttataagca agacatggaa        60
     atagagtatg aatatttggc tatgcagtta attaaatcag gtaaattacg tatagatact       120
     aatgattgtt gtaattttgc aagatttacc gatcctgcac ttaatataag cttaatggtt       180
     agtaacgaag aactaacaag accgcattta atacctgaga ctacgaagct ttttcaaagt       240
     ttatacaaaa attctgcttc agatcaaaaa ataaactcaa tctttgataa tttaaaaaaa       300
     caaatacaaa agctacagcc agttaagcaa gaagtcactg aaatgttggc acgtcttttt       360
     gtacaatctg ctcacccaat cgtaataaga tggctccttc ttaataagac agaagtattc       420
     cttacatatt cgcataatat aggtgatatg atggatattg ttagctggca acgagtagga       480
     ggtaatagcg gtatgcaaag cactaacggc aaggacatag ctatttttgt ctcatgtggc       540
     ggtaaccctt ttgctgaaaa caataaagcg catccgagtt atggtgatgg ctttgctgca       600
     gtagcaagat tgcagattat tgcagctcaa gaacttggac attttgcaga tataaaaaga       660
     gatgataaag gtagacaact aacgcgtcat gcagctaatt tttcttgtac taaagctacc       720
     gataaagtac gccttgctag gaaaagtgat ataatacatt gtaataattt gtttaataag       780
     ctccttaaag caggtatgaa aaaacaacta gagtatgaaa caaaacttaa attttataat       840
     acaaataaaa tcagcggctt aaaagttaat gctataaaat tcatgatttt gatatataaa       900
     ttccggcttt taagttatag tagtaagaat aatctaatat ttataagaaa atttaaaact       960
     gataaatata tggcattaat gattgagact atgtttaaag atatgcaagc taatttgtca      1020
     ccgaacgctg aagtttataa aaataaaaac cctgaaattg aagaagctat agcatgtatt      1080
     gaagcactag ctagagtacc acaacaaaca ataaaatggg gatatttaac taccaaagaa      1140
     ataatgcatc acctttataa aatatattat aatgaggtta taccttcttt aattactagc      1200
     tataattctt tcactggtga aaattataaa cgtgatttta aaaaaaacaa aagtagcttc      1260
     ttttctaaaa tcaatatctt taataacaaa aagctaatat taaaaccggt gagggaatta      1320
     taa                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page