(data stored in SCRATCH3701 zone)

EMBL: AE017197.PPCE

AE017197.PPCE        Location/Qualifiers
FT   CDS_pept        complement(206220..208382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppcE"
FT                   /locus_tag="RT0165"
FT                   /product="Post-proline cleaving enzyme"
FT                   /EC_number="3.4.21.26"
FT                   /db_xref="EnsemblGenomes-Gn:RT0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03649"
FT                   /db_xref="GOA:Q68XJ3"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:4HVT"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XJ3"
FT                   /protein_id="AAU03649.1"
FT                   /translation="MIKIICYLTIILLTFCIDAMEDNNKQIFNPKETKFLEEAEGVEAL
FT                   EWAKERTSKTEKALQAMQEYKQIKKEIETIFYDQRKTPYGVIRKGYVYNFWMDDKNPQG
FT                   LWRRTLVDNYSKDKPNWEVLIDFDKLSKKIGKKVAYRGVSNCFQNPNRYLISMSFGGKD
FT                   EMFFREWDLEKKDFVKNGFEPITNSGKLLEGKFTYPTWINKDTIIFNLVLHKNEITSSL
FT                   YPNSLYIWKRGESIEKAKKLFEVPKEYIYVSAGKLLSDTISSSLIFISANKDFYNYDNY
FT                   ILDTKYKNLKLQKINMPSDATLQGSFKEYVFWLLRSDWKFKSHNIKAGSLVALHFTDLL
FT                   KTESDKTSLKILFTPTANEVFNFISTTKDRVFLATYDNVVAKVVTFTLENEQWTKPVVL
FT                   KLPYQNAIFGMSSYEEEEEALITIENSIVPPTIYLWVKTHELKIIRKALYSFDSENYVL
FT                   EQKEATSFDGVKIPYFLVYKKGIKFDGKNPTLLEAYGGFQVINAPYFSRIKNEVWVKNA
FT                   GVSVLANIRGGGEFGPEWHKSAQGIKRQTAFNDFFAVSEELIKQNITSPEYLGIKGGSN
FT                   GGLLVSVAMTQRPELFGAVACEVPILDMIRYKEFGAGHSWVTEYGDPEIPNDLLHIKKY
FT                   APLENLSLTQKYPTVLITDSVLDQRVHPWHGRIFEYVLAQNPNTKTYFLESKDSGHGSG
FT                   SDLKESANYFINLYTFFANALKLKIN"
     atgataaaaa ttatatgcta tttgacaatt attttattaa ccttttgtat tgatgctatg        60
     gaagataata ataaacaaat atttaaccca aaagagacaa aatttttaga agaagctgaa       120
     ggagtggaag cgctagaatg ggcaaaagaa cgtactagta aaacagaaaa agctttgcaa       180
     gcaatgcagg aatataaaca gatcaaaaaa gaaatagaaa ctattttcta tgaccaaaga       240
     aaaactccat atggtgttat acgtaaaggt tatgtgtata atttttggat ggatgataaa       300
     aatccgcaag gattatggcg tagaacgtta gttgataatt actctaaaga taaaccaaat       360
     tgggaagtgc taatcgattt tgataaatta tcaaaaaaaa tcggtaaaaa agtagcctat       420
     cgaggtgtaa gtaattgttt ccaaaaccct aatcgttact taatttctat gtcctttggt       480
     ggtaaagatg agatgttttt tagagaatgg gatttagaaa aaaaagattt tgttaaaaat       540
     ggctttgaac cgataacaaa tagcgggaaa ttattagaag gaaaatttac ttatcctact       600
     tggatcaaca aagatactat tatatttaat ctagttttgc ataaaaatga aataacgtcc       660
     tctttatatc ctaactcgct atacatatgg aagcgcggag aatctataga aaaagctaaa       720
     aaactttttg aagtaccaaa agaatatata tatgtatcag ctggtaaact tttatcagat       780
     actatttctt catctttaat atttatatct gcaaataaag atttttataa ttatgacaat       840
     tatattttag atactaaata taagaactta aaattacaaa aaataaacat gccatcagat       900
     gcaacacttc aaggttcttt taaagaatat gtattttggt tgctgcgttc tgattggaaa       960
     tttaaaagtc ataatataaa ggcaggctcg ctggttgcat tacactttac agacctacta      1020
     aaaacagaaa gtgataaaac tagcctaaaa atattattta caccaacagc gaatgaagta      1080
     tttaatttca taagcacaac taaagataga gtatttttag caacttacga taatgtggtt      1140
     gcaaaagttg taacatttac tttagaaaat gaacaatgga caaaaccggt agtcttaaag      1200
     ctaccttatc agaacgcaat ttttgggatg tcttcttatg aagaggaaga agaggcatta      1260
     attactatag aaaattcgat agttccacca actatctatt tatgggttaa aactcatgag      1320
     ttaaaaatta ttcgaaaagc tttatactct tttgatagtg aaaattatgt tttagaacaa      1380
     aaggaagcta caagctttga tggagttaaa ataccatatt ttcttgttta taagaaaggg      1440
     ataaaatttg acggtaaaaa tccaacatta cttgaagcat atggtggatt ccaggtaatc      1500
     aatgcaccat atttttcacg gattaaaaat gaagtatggg ttaaaaatgc tggtgttagt      1560
     gttcttgcta atatcagagg tggtggagag tttggtcctg agtggcataa gtcagctcaa      1620
     ggaataaaac gtcaaacagc ctttaatgat ttttttgcag tatcagagga gttaataaag      1680
     caaaatatta ctagccctga atatttagga attaaaggag ggagtaacgg cggattacta      1740
     gtcagtgttg caatgacaca acgtcctgag ttatttggtg ctgtagcatg cgaagtaccg      1800
     atacttgata tgatacgtta taaagaattt ggagcaggac attcatgggt aactgaatat      1860
     ggtgatccag aaattccaaa tgatttatta catattaaaa aatatgcacc gttagagaat      1920
     ttatctttaa cacaaaaata cccaactgtg ttaattacag attcagtatt ggatcagcgt      1980
     gtacacccat ggcatggaag aatttttgag tatgtacttg cacaaaatcc aaatactaaa      2040
     acttactttc tagaaagtaa agatagtgga catggtagtg gtagtgattt aaaagagagt      2100
     gcaaattatt ttattaatct ctatacattt tttgcaaatg ctttaaaatt gaaaattaat      2160
     taa                                                                    2163
//

If you have problems or comments...

PBIL Back to PBIL home page