(data stored in SCRATCH3701 zone)

EMBL: AE017197.PRFB

AE017197.PRFB        Location/Qualifiers
FT   CDS_pept        complement(333479..334501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="RT0265"
FT                   /product="peptide chain release factor 2 (RF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:RT0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03746"
FT                   /db_xref="GOA:Q68X96"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X96"
FT                   /protein_id="AAU03746.1"
FT                   /translation="MRLTELEELTADPSLWNNNANAQILLREKTNIEEKLNVFNNLKSN
FT                   FEDILELEAMAEVENDFETLNQIEQDFKKLSIIAAKLETECLFSDESDYNNCFLEINAG
FT                   AGGTESHDWASIMMRMYLRFAERLGFKTQIINMINGEEVGIKSCTIRIIGKRAYGWFKT
FT                   EAGVHRLVRISPFNAAGKRMTSFASSWVYPEIDDDIAITIEDKDLRIDTFRASGAGGQH
FT                   VNTTDSAVRITHIPTNTVTQCQSDRSQHKNKAQAMKMLQAKLYKLEMQKRTDSVDKQNA
FT                   NKTDNSWGHQIRSYVLQPYQIVKDLRTDYETSDTKGVLDGNLENFVSASLAMNASGNKK
FT                   "
     ataagactta cagaattaga agaattaaca gcagatccaa gtttatggaa taataatgct        60
     aatgcacaaa tattactaag agaaaaaact aatatagaag aaaaactaaa tgtttttaat       120
     aacctcaaat caaattttga agatatttta gaacttgaag caatggctga agtcgaaaat       180
     gatttcgaga ctcttaatca aattgaacaa gactttaaaa aattaagtat cattgccgct       240
     aaacttgaaa ctgagtgctt attttcagat gaatcagact acaataactg ctttttagaa       300
     attaatgctg gagcaggagg aactgaaagt catgattggg catcgattat gatgcgtatg       360
     tatttacgtt ttgctgaacg acttggtttt aaaacacaaa taataaatat gattaatggc       420
     gaagaagtag gcattaaatc atgtacgatt agaataatag gtaaacgagc ttacggctgg       480
     tttaaaacag aagcaggagt gcataggcta gtgcgcattt ctccatttaa tgcagcaggc       540
     aaaaggatga ctagctttgc aagtagctgg gtatatccag aaattgatga tgatatagca       600
     atcactattg aagataaaga tttaagaatc gatactttta gagcatcagg tgcaggcgga       660
     caacacgtta atacaacaga ttctgcagta cgtatcacgc atataccaac aaatacggta       720
     acacaatgtc aaagtgacag atcacaacat aagaataaag ctcaagcaat gaagatgctt       780
     caagcaaaac tctataagct tgaaatgcag aaacgtactg acagtgttga taaacagaat       840
     gctaataaaa ccgataatag ttgggggcat caaattagat catatgtttt gcaaccttat       900
     caaattgtaa aagatctacg tactgattac gaaacttccg atactaaagg agtacttgac       960
     ggtaaccttg aaaattttgt ctccgcaagc cttgctatga atgctagtgg taataaaaaa      1020
     taa                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page