(data stored in SCRATCH3701 zone)

EMBL: AE017197.RADA

AE017197.RADA        Location/Qualifiers
FT   CDS_pept        683023..684360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="RT0534"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:RT0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04003"
FT                   /db_xref="GOA:Q68WI9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WI9"
FT                   /protein_id="AAU04003.1"
FT                   /translation="MTRDKKHYICSNCANISHKWSGQCFDCGVWGSIVEEIISTNKSII
FT                   TGSKQTFDKLSCDVSEPLRISTPISELNRVLGGGLVLGSAILIGGEPGIGKSTLLLQLT
FT                   ASNFESKMRCLYITGEESLDQIKLRAIRLNITNYNTAILAATNLEDIIASIDDNNNNID
FT                   LVVIDSIQTITTKELSSPPGTVSQIRTCANELVNYSKQNNIIILLSCHVTKDGQIAGPK
FT                   ILEHLVDTVLYFEGDHNNHFRILRSYKNRFGSIGEIGVFEMSSSGILEVTNHSELFLMK
FT                   REHNVVGTSIFAGVEGSRPLLMEVQALIVPSNMLTPKRSAVGWDANRLSMILAVLSSRI
FT                   GLNLANYEIYLSIAGGLKITDPASDLAVAASLISAATSIPLPEHSVFFGEISLSGEIRK
FT                   TAKAETRIKEAVKLGFNKVICSKLENLTYDFICSCTHLQDLKEIIK"
     atgacaagag ataaaaagca ttatatatgt tctaactgtg caaatattag tcacaaatgg        60
     tcaggacagt gctttgattg cggtgtatgg ggtagtattg tcgaagagat aataagcaca       120
     aataaatcaa ttattaccgg tagcaaacaa actttcgata aactttcatg tgacgtatct       180
     gaaccgttac gcatctccac acctataagt gaattaaata gagtcttggg cgggggttta       240
     gtacttggtt ctgctatatt aataggagga gagcctggta taggtaaatc tactttatta       300
     ctacagctaa cagcaagtaa ctttgaatca aaaatgcggt gcttatatat aacaggtgaa       360
     gaatctttag accaaataaa attaagagca ataagactaa acataactaa ctataatacg       420
     gctattttag cagctactaa tttagaagat attattgcaa gtatagatga taataacaat       480
     aatattgatc tagtagttat tgattctatt caaacaatta caacaaaaga attatcatca       540
     cctccaggta ctgtatcaca aattcgtaca tgcgcaaatg agcttgttaa ttattctaaa       600
     caaaataata taattatttt attaagctgt catgtaacta aggatggaca aatagcaggc       660
     cctaagatac ttgagcattt agttgataca gtattatatt ttgagggaga tcataataat       720
     cattttcgta ttctacgctc atataaaaac cgttttggca gtattggtga aataggggta       780
     tttgaaatga gtagtagcgg tattcttgaa gtaacaaatc actctgaact gtttttaatg       840
     aagcgagagc ataacgttgt aggtacatct atttttgcag gtgtcgaggg ttcaagaccg       900
     ttacttatgg aagtacaggc actcatagta ccatcaaata tgctaactcc taaacgttct       960
     gctgtaggtt gggacgcaaa cagattatca atgatacttg ctgtacttag tagtaggata      1020
     ggacttaatc ttgctaacta tgaaatatat ttaagtatag ctggagggct taaaattact      1080
     gatcctgcct ctgatttagc agtagcagca agtttaatat ctgcggcaac tagcatacca      1140
     ctaccagaac atagcgtatt tttcggtgaa ataagtttat caggagaaat aagaaaaact      1200
     gcaaaagcag aaacaagaat aaaagaagct gtaaaacttg gatttaataa ggttatttgc      1260
     tctaaacttg aaaatttaac atatgacttt atatgttcct gtacacattt acaggatcta      1320
     aaagagataa ttaaatga                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page