(data stored in SCRATCH3701 zone)

EMBL: AE017197.RECF

AE017197.RECF        Location/Qualifiers
FT   CDS_pept        134379..135461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="RT0100"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:RT0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03586"
FT                   /db_xref="GOA:Q68XQ6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XQ6"
FT                   /protein_id="AAU03586.1"
FT                   /translation="MKNIFLHSLNLENYRNFKNLELKIDNIPIILTGENGSGKTNILEA
FT                   ISLFYPGRGLRSSKLTDICKTSEDYCRVKALLQSKLGIADFSTHIKRNSNRRITEYNAS
FT                   KIANNELSKFTSMVWLTPQMEGIFTSSSTDRRKFLDRIVYNFDTKHAELLNKYEYYMHE
FT                   RNKILAEDIRDNNWLKIIEENMANISNIIANNRLKTIRFMQQAIDEIENEFPKADLSID
FT                   GIIEQKILNVEEDIVSFIITELYQTRSKDKLLGRTSFGIHKSDFLVKHQKKNILAKFCS
FT                   TGEQKAILIAIILAEMNSTIKLTKITPILLLDEIFVHLDDKRRQYLMDFFTALNIQLWV
FT                   TATNLDGIENFANKAQLIKL"
     atgaaaaata tatttctaca ttctttaaat cttgagaatt atcgtaattt taaaaatctt        60
     gaactaaaaa tagataatat acctataatt ttaacaggtg aaaatggtag cggtaaaact       120
     aatattttag aagctatatc gctgttctat ccaggtagag gcctgaggtc atcaaaactt       180
     actgatatat gtaaaacttc agaagattat tgtagagtta aagctctatt gcaaagcaag       240
     ctagggattg cagactttag tacgcatatt aagcgtaatt caaataggcg cataaccgaa       300
     tataacgcaa gtaaaatagc taataacgag ttaagtaaat ttactagtat ggtatggctc       360
     actccacaaa tggaaggaat ctttacaagc agcagtactg atagaagaaa atttcttgat       420
     agaatagttt ataactttga tacaaaacat gcagaactat taaataaata tgaatattac       480
     atgcatgaga gaaataaaat tttagcagaa gatataaggg ataataattg gcttaaaatt       540
     attgaagaaa atatggctaa tatttctaac attattgcta ataatcgttt aaaaaccata       600
     agatttatgc agcaagcaat agatgagatt gaaaatgaat tcccaaaagc agacttatca       660
     attgatggca ttattgaaca aaaaatatta aatgtggaag aagatattgt tagctttatt       720
     attacagaac tttatcaaac aagaagtaaa gataaactac ttggtcgcac tagttttgga       780
     attcataaaa gtgatttttt agtaaagcat cagaagaaaa atatcttagc aaaattctgt       840
     tctactggtg aacaaaaagc gatattaatc gcaataatcc ttgctgaaat gaattccact       900
     attaagctaa ctaaaataac gccaatttta cttttagatg agatttttgt gcatctagat       960
     gataaaagac gtcaatattt aatggatttt tttactgctt taaacataca gctatgggtc      1020
     actgctacta atctagatgg aatagaaaat tttgcaaata aagcacaatt aattaagtta      1080
     taa                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page