(data stored in SCRATCH3701 zone)

EMBL: AE017197.RECN

AE017197.RECN        Location/Qualifiers
FT   CDS_pept        complement(218612..220276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="RT0173"
FT                   /product="DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:RT0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03657"
FT                   /db_xref="GOA:Q68XI5"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XI5"
FT                   /protein_id="AAU03657.1"
FT                   /translation="MFYSLSVKNFILIDELEIEFNKGLCVITGETGAGKSILLDAILFC
FT                   LGYKTSNNVIKHGKDYTVVNIIFSLNDEIKKFLIQNFIEPEELLLVKCLQKVEGRKNFF
FT                   INNQIVTKTLMKQLANYLFELHGQNNNITLLEASTQRDILDSYGNLLEFRVQLAKCYQI
FT                   WQNTRKEIEEITVKQNEIEQEIDYLSFVTEELTKLNIQIGEEETLTNIRKDLQNKGKNL
FT                   QLIRDIIAEINNPEINISINRACKLLARQDYNDRFNAVVTSLEEAYNNLEVARQELSNI
FT                   LGSFTYEEYNLEETEERLFLIKAISRKYNVPANELGIFLDKSLEQLGILKNKIANSNKL
FT                   QAQEVLLQEQYYKLASDLSAKRLIAAKHLEESLNQELKQLKMENANFKIEVKTRIDPTA
FT                   SGNDDIVFKASTNPGMKIEAINKIASGGELSRFMLALKTSLFDKMIKPSIIFDEIDVGI
FT                   AGEAADKIGDRLKKLSSVTQVIVITHQPQVAGKADLHIKIEKTQLEQETKVKVKALNLA
FT                   ERQTELARMISGKTITAASLKVAKELLHPVAFSHDQK"
     atgttctata gtctctcagt taaaaacttc attctgatag acgaactgga aattgagttt        60
     aataaaggtt tgtgtgttat taccggtgaa acaggcgctg gtaaatctat tttacttgat       120
     gctattttat tttgtttagg ttataaaacc tcaaacaatg taataaagca tggcaaagat       180
     tacactgttg ttaatataat attttcttta aacgatgaaa taaaaaaatt tctaatccaa       240
     aattttattg aacctgaaga gttattgctt gtgaagtgtc tgcaaaaagt agaaggacgg       300
     aaaaattttt tcattaataa tcaaatagtg actaaaacac ttatgaagca attagctaat       360
     tatttatttg aacttcatgg acaaaataat aatattacac ttctagaagc aagtactcaa       420
     cgtgatattt tagatagtta tggaaatctt ttagaatttc gtgtacaact tgcaaaatgt       480
     tatcaaattt ggcaaaatac tcgaaaagaa attgaagaaa taacagtgaa gcaaaatgag       540
     atagaacaag aaattgatta tttgagtttt gtaacagaag aattaactaa gctgaacatt       600
     caaataggtg aagaagaaac attaacaaat atacgaaaag atttgcaaaa taaaggtaag       660
     aatttacagc taataagaga tattatagca gaaattaata accctgaaat aaatatatca       720
     attaatagag catgtaaact attagcaaga caagactata atgatcgttt taatgctgtc       780
     gttacaagtt tagaggaagc atataataat ttagaagtag cacgtcaaga attatcaaac       840
     atcttaggta gttttactta tgaggaatat aatcttgaag aaacagaaga gcgattattt       900
     ttaataaaag ctattagtcg taaatataat gtgcctgcaa atgagttagg tatcttttta       960
     gataaatctt tagaacaact tggaatatta aaaaataaaa tagcaaatag taataagtta      1020
     caagctcaag aagtgctatt acaggaacaa tattataaac tagcaagtga tttatctgca      1080
     aagcgtctta tcgctgcaaa acatttagaa gaatcattga atcaagaatt aaaacagctt      1140
     aaaatggaga acgcaaattt taagattgag gtcaaaacta gaatagatcc tactgcaagt      1200
     ggtaatgacg atattgtatt taaagcttct actaacccag gcatgaaaat agaagcaatt      1260
     aataaaatcg cttctggtgg tgaattatca cggttcatgc ttgctttaaa aacttcttta      1320
     tttgataaaa tgataaaacc atctattata tttgatgaaa tagatgtagg tattgctgga      1380
     gaggctgcag ataaaatagg tgatcggtta aaaaaactta gctcagttac acaggtaata      1440
     gttattacac accagcctca agtagcaggt aaagcggact tgcatataaa aattgaaaaa      1500
     acacagttag aacaagaaac gaaagtcaaa gtaaaagctt taaatctagc tgaaagacag      1560
     acagaacttg ctcgaatgat ttcaggtaaa acaatcaccg ctgcaagttt aaaagtagca      1620
     aaagagttat tacatccagt agctttttca catgatcaaa agtaa                      1665
//

If you have problems or comments...

PBIL Back to PBIL home page