(data stored in SCRATCH3701 zone)

EMBL: AE017197.RECR

AE017197.RECR        Location/Qualifiers
FT   CDS_pept        534807..535406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="RT0425"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:RT0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03902"
FT                   /db_xref="GOA:Q68WU0"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WU0"
FT                   /protein_id="AAU03902.1"
FT                   /translation="MNKTNDIDQLIYLFSKLPGLGIRSARRIVLYLLQDKDVRLKSLIN
FT                   HLIELDKKIVKCEICGNMDTKNICHICSSEHRDKSTIAIVETVAELCAMERSGNFKGLY
FT                   HVLGHNLSAASRQNPRILRLPELLKRCFVENIKEVIIATNSTLEGQTTAYFIIEYLKEH
FT                   PAKISRLASGIPIGGELDYLDEGTLSAAINLRQPCE"
     atgaataaaa caaatgatat agaccagtta atttatcttt tttcaaaatt acctggtctt        60
     ggtattagat cagcaaggcg tatagtactt tatctattgc aagataaaga tgtaaggtta       120
     aaaagcctca ttaatcacct tatagagctt gataagaaaa tagtaaaatg cgagatttgt       180
     ggtaatatgg atacgaaaaa tatttgccat atttgttctt ctgaacatag agataagtcg       240
     actattgcta ttgttgaaac tgtagctgaa ttatgtgcaa tggagcgtag cggtaatttt       300
     aaaggtttat atcacgtact cggtcataat ttatctgcag ctagtagaca gaaccctcgc       360
     atactccgtt tacctgaatt acttaaaagg tgttttgtag aaaatattaa agaagttatt       420
     attgctacta attctacttt agaaggtcaa actactgctt attttattat agaatattta       480
     aaagagcatc ctgctaaaat ttctcgactt gcaagcggta tacctattgg aggtgaactt       540
     gactatttag atgaagggac cttatctgct gctattaacc tacgtcaacc ttgcgaataa       600
//

If you have problems or comments...

PBIL Back to PBIL home page