(data stored in SCRATCH3701 zone)

EMBL: AE017197.RODA

AE017197.RODA        Location/Qualifiers
FT   CDS_pept        complement(342450..343550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /locus_tag="RT0271"
FT                   /product="rod shape determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03751"
FT                   /db_xref="GOA:Q68X91"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X91"
FT                   /protein_id="AAU03751.1"
FT                   /translation="MHKNYLEQLQKLPITLIVLIIVICCIGFIVLYSAANSNLQPWAYK
FT                   QIINFCIFLPLAIIIALIDLRIIFRLSYIFYFCALALLIAVELFGSTAMGGKRWIDLGI
FT                   VKLQPSEPIKISIVLMLARYFHRSTSDDLTKLYKVIIPIIGILTPAFLIIREPDLGTGM
FT                   IVLIVAAIIFFAAGFRIKYFIILALAALISMPIAWNMMYDYQKKRVMVFLDPEHDPLGA
FT                   SYNIIQSKIAIGSGSLFGRGLNQGSQSHLDFLPEHQTDFIFATFAEEFGFIGGMFLLIL
FT                   YFALITISLLIGVNCREIFSKLMVIGITSILFSHVFINIAMVMGLLPVVGVPLPFISYG
FT                   GTMIASMLIGFGLVMNAQIHGHATLN"
     atgcataaaa attatctaga acaattacaa aaattaccaa tcactttaat tgtactaatc        60
     attgtaattt gctgtattgg atttattgtc ctttattctg cagcgaatag caatttacaa       120
     ccttgggctt ataaacaaat tatcaatttt tgtatattct taccattagc tattattatt       180
     gcattaattg atttacggat aatatttagg ttatcttata tattctattt ttgtgcacta       240
     gctttactaa tagcagtaga gctttttggt tcaactgcca tgggcggaaa gagatggatc       300
     gatcttggta tagtaaaact tcaaccttct gaaccgataa aaatctctat tgtattaatg       360
     cttgctagat attttcatcg atctacaagt gatgatctaa caaaactata taaagttatc       420
     ataccgatta taggaatttt aacacctgct tttctaatca ttagagaacc agatttaggt       480
     acaggtatga ttgttttaat tgttgcagca ataatatttt ttgcagcagg ttttagaata       540
     aaatatttca taatacttgc gcttgctgca cttattagca tgcctattgc ttggaatatg       600
     atgtatgatt atcaaaaaaa acgagtgatg gtttttttag atccagaaca tgatccactt       660
     ggtgcgagct ataacattat tcagtctaaa atcgctatag gttcaggtag cctatttgga       720
     cgtgggttaa accaaggtag ccaaagccac ttagattttc tacctgaaca tcaaacagat       780
     tttatctttg caacctttgc tgaagagttt ggttttatag gcggcatgtt tttactaata       840
     ttatattttg cacttatcac tatttcttta ttaattggcg taaattgcag agaaattttt       900
     agtaaattaa tggtaatagg tatcacttca atcttattta gtcacgtatt tattaatata       960
     gctatggtga tgggactact tccagtagtg ggcgtacctc taccatttat ttcttacgga      1020
     ggaacaatga ttgcatcaat gctaatagga tttggacttg taatgaatgc gcaaatacac      1080
     ggacatgcta ctttaaacta g                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page