(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPLA

AE017197.RPLA        Location/Qualifiers
FT   CDS_pept        158545..159258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="RT0126"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03611"
FT                   /db_xref="GOA:Q68XN1"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XN1"
FT                   /protein_id="AAU03611.1"
FT                   /translation="MSNKDIFVKISGSKKIREAREKVKSDTLYNLTSAVERLKSASYVK
FT                   FDPTLEIVMKLGIDPRHSDQIVRGVVNLPAGTGKIIRVAVICKEEREEEAKSAGADLVG
FT                   SINIIDEIKSGQINFDVCIATPDMMSMISSVARILGPKGLMPNPKLGTVTLDIKNAIKN
FT                   AKSGQVEYRAEKAGIIHAGLGKLSFSDQDLLKNLNAFIGAVIKAKPVGLKGSYLKAIYL
FT                   SSTMGASVQIDLTSI"
     atgtcaaata aagatatttt tgtcaaaatt agtggtagta aaaaaataag agaagctaga        60
     gaaaaagtaa aatcagatac cttatataat ttaacaagtg cggttgaacg gttaaagtca       120
     gcatcatatg ttaagtttga tccaacttta gaaatagtaa tgaagcttgg cattgatcct       180
     aggcattcag atcaaattgt acgtggcgta gttaatttac ctgccggtac tggtaaaata       240
     ataagagttg ctgttatttg taaagaggaa agagaagaag aggccaaaag tgctggagca       300
     gatttagttg gttcaataaa tattattgat gaaattaaat ctgggcaaat taatttcgat       360
     gtatgtatag ctactcctga tatgatgtcg atgataagtt cagttgcaag aattttaggc       420
     ccaaaaggtt taatgcctaa tcctaaactt ggtacagtca ctttagatat taaaaatgct       480
     attaaaaatg ctaaaagcgg tcaggtagaa tatagagcag agaaagcagg tataattcat       540
     gcaggtcttg gaaaattatc tttttcagac caagatttat taaaaaattt aaatgcattt       600
     attggggcag taattaaagc aaaacctgtt ggattaaaag gtagttattt aaaagcaata       660
     tatttatctt ctactatggg agcatcggta caaatagatt taactagtat ataa             714
//

If you have problems or comments...

PBIL Back to PBIL home page