(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPLD

AE017197.RPLD        Location/Qualifiers
FT   CDS_pept        complement(826714..827337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="RT0650"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:RT0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04113"
FT                   /db_xref="GOA:Q68W79"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W79"
FT                   /protein_id="AAU04113.1"
FT                   /translation="MKTKILSLANEEVGEITLNKDIFAVEFIRDDIIKQVIDWQRAKAM
FT                   SGNHKTKTVSEVSGTTKKPFKQKGTGNARQGSLRSIQMRGGGISHGPKVRSHAIKLPKK
FT                   VRKLGLIHALSEKCAAGKLLIINSLKLEKPKTSVLVNLLNKFQGQSFFIIDGNKVDTNF
FT                   SLATKNIYNTLIVPQIGANVYDIIRHEYVLLSQEAVSFLEERLR"
     atgaaaacta aaatattaag tcttgctaat gaagaagttg gtgagattac tttaaataaa        60
     gatatattcg ctgttgagtt tatcagagat gatataataa agcaggttat cgattggcag       120
     agagctaaag caatgtccgg taaccataaa actaaaacag tatcagaagt atcaggcaca       180
     acaaaaaaac cttttaagca aaaaggtaca ggcaatgcac gacaaggttc tcttaggtct       240
     atacagatgc gtggtggtgg tatatcacat ggtcctaagg tacggagtca tgcaataaaa       300
     ttacctaaaa aagtacgaaa acttggttta attcatgctt tatctgagaa atgtgctgca       360
     ggaaaattat taataataaa ttctttaaag ttagagaagc ctaaaacgtc tgttcttgta       420
     aatttattaa ataaatttca aggtcagagt ttttttataa ttgatggaaa taaagtagat       480
     actaattttt ctttagctac aaaaaatatt tataatacgt tgattgttcc acaaatagga       540
     gcgaatgttt atgatatcat acgacatgag tatgtactct tatcacaaga agctgtgagc       600
     tttttagaag agaggttaag atga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page