(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPLE

AE017197.RPLE        Location/Qualifiers
FT   CDS_pept        complement(822112..822651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="RT0639"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:RT0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04102"
FT                   /db_xref="GOA:Q68W90"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W90"
FT                   /protein_id="AAU04102.1"
FT                   /translation="MLRFKELYKKKIIESLKKEFSFKNQHEIPQIKKIVINMGVGEAIA
FT                   DSKVINNALNDLTLISGQKPIVTLARKSIATFKLRENMKIGCKVTLRKDRMYDFLERLV
FT                   IVALPRVKEFRGFSYKSFDGKGNFTFGLKEQIVFPEINYDKIDTIRGMDITIVTSAKTD
FT                   QESKFLLSGFNLPFYN"
     atgttaagat ttaaagaatt atataagaaa aaaattattg aaagcttaaa aaaagaattt        60
     tcttttaaaa atcaacatga aataccgcaa attaaaaaaa ttgttataaa tatgggcgta       120
     ggtgaagcaa tagcagattc caaagtaatt aataatgcac taaatgatct tactttgatt       180
     tcaggtcaaa agccgattgt aactttagca agaaaatcta ttgcaacctt taagttacgt       240
     gaaaatatga aaataggttg caaggttaca ttacgtaaag atagaatgta tgatttttta       300
     gaaaggttag taattgttgc attaccgcgt gttaaagaat ttcgtggctt ttcttataag       360
     agttttgatg gtaaagggaa ttttactttt ggattaaaag agcagatagt ttttcctgaa       420
     attaattacg ataaaatcga tacaataagg ggtatggata ttacaatcgt tacatctgct       480
     aaaacagatc aagagagtaa gtttttatta tctggattta atttaccttt ttataattaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page