(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPLF

AE017197.RPLF        Location/Qualifiers
FT   CDS_pept        complement(820830..821363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="RT0636"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:RT0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04099"
FT                   /db_xref="GOA:Q68W93"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W93"
FT                   /protein_id="AAU04099.1"
FT                   /translation="MSRVGKLPITIPEGVKVGLNDLEVKISGPKGELSKTFKGNIAIIM
FT                   EENKLVVKPLAVNKNARSMWGTARSIIYNMVTGVKEGFKLKLEINGVGYRAMVKGKYLN
FT                   LMLAKSHNTKIEIPSNIKIDLPKQNIILLEGIDKEKLGQFASIIIKQRPPEPYKGKGIK
FT                   FENKFIQRKEGKKN"
     atgtcacgtg ttggaaaatt accgattact atacctgaag gtgtaaaagt tggtttaaat        60
     gatttagaag taaaaatatc cggtcctaag ggtgaattat caaaaacttt taaaggtaat       120
     atagctatta taatggaaga aaataagctt gttgtaaaac ctttagctgt aaacaaaaat       180
     gcacgttcta tgtggggtac tgcaaggagc ataatatata atatggtcac tggagttaaa       240
     gaaggtttta aattaaagct tgaaattaac ggtgtcggtt atagggcaat ggtaaaaggt       300
     aaatatttaa atttgatgct tgctaaaagc cataatacaa aaattgaaat accatcaaat       360
     attaaaatag atctgcctaa gcagaatatt attcttcttg agggaataga taaagaaaaa       420
     ttaggccaat ttgcttcaat tattataaaa cagagaccac ctgagcctta taaaggtaaa       480
     ggaattaaat ttgaaaataa atttatacag cgtaaagaag gtaagaaaaa ttaa             534
//

If you have problems or comments...

PBIL Back to PBIL home page