(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPLI

AE017197.RPLI        Location/Qualifiers
FT   CDS_pept        complement(116339..116854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="RT0089"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:RT0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03575"
FT                   /db_xref="GOA:Q68XR7"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XR7"
FT                   /protein_id="AAU03575.1"
FT                   /translation="MEIILIKPVRKLGKIGDILKVANGFGRNYLLPQKLAIRATKSNKE
FT                   LIVKQKHEFEAKDKQIRAEVEKINTLIKDQQLVFIRQTSDDCKLFGSVTNKDIADKLSK
FT                   NISYNISHSNVILDKQIKSTGIYTVEIRLHAELTAIVTVIVARSDSEAQDYLREQKTEN
FT                   SADLAESE"
     atggaaatta ttttaataaa acccgtaaga aaattaggta aaattggcga catactcaaa        60
     gtagcaaatg ggtttggtcg taattatctt ttgccgcaaa aattagctat tagagctact       120
     aagtctaata aagagctaat agttaaacaa aaacatgaat ttgaagcaaa agataagcaa       180
     ataagagcag aagtagaaaa aattaacacc cttattaagg atcaacagtt agtttttatc       240
     cgtcaaacat cagatgactg taagcttttt ggttcagtga ctaataaaga tatagcggat       300
     aagttatcta aaaatatatc ttataatatc tctcattcaa atgttattct tgataaacaa       360
     attaaatcta ccggaattta tacggttgaa ataaggcttc atgcagagct tactgctata       420
     gtgacagtta ttgtagcaag atcagactca gaagcacaag attacttacg tgaacaaaaa       480
     actgaaaatt cagcagattt agctgaatct gaataa                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page