(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPLJ

AE017197.RPLJ        Location/Qualifiers
FT   CDS_pept        159348..159857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="RT0127"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:RT0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03612"
FT                   /db_xref="GOA:Q68XN0"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XN0"
FT                   /protein_id="AAU03612.1"
FT                   /translation="MLRSEKPVAVEDIVNIYKESPSVIITHYHGLTVSQVSSLREALKS
FT                   KEVGFKVVKNTLAKIAAKHTGLDSITDLFAGPSAIVYSKEPVEMARLVVNFANSNDNLK
FT                   IIGGIVDNHILDTYAIKELAKLPSLHELRGKIVGLLQAPATKVVGVLQATSSSIARVIH
FT                   AHAIKH"
     gtgttaagat cagaaaaacc ggtagcagta gaagatattg tgaatattta taaggaatcg        60
     ccatctgtaa ttattactca ttatcatgga ttaactgtta gtcaagtgag ttcacttaga       120
     gaagcactaa aatctaaaga agtaggtttt aaagtagtta aaaatacttt agctaaaata       180
     gctgcaaagc acactgggct tgatagtatt actgatttat ttgctgggcc tagtgcgatt       240
     gtttattcta aagaaccggt tgagatggca agattagtag ttaattttgc taactcgaat       300
     gataatctta agattattgg tggcatagtt gataatcata tattagatac atatgcaata       360
     aaagaacttg ctaagctacc ttcattgcat gagcttagag gtaaaattgt tgggttacta       420
     caagcaccgg ctactaaggt tgtaggtgtt ttacaagcta cgtcttcgag tatagcaaga       480
     gtaatacacg cacatgctat taaacattaa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page