(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPLK

AE017197.RPLK        Location/Qualifiers
FT   CDS_pept        158105..158542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="RT0125"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:RT0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03610"
FT                   /db_xref="GOA:Q68XN2"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XN2"
FT                   /protein_id="AAU03610.1"
FT                   /translation="MSQKTIKGYINLIIPAAGATPAPPIGPALGQRKVNIAAFCKDFND
FT                   ATNGMEKGVPLPTVITVYDDNSFSFKVKTPPASYFLKKYAKITKGSSATKKEAMVGKVT
FT                   LDACREIAKLKISDLNTKNIEAATKIICGSAASMGLEVVGN"
     atgtctcaga aaacaataaa ggggtatatt aacttaataa ttcctgctgc tggagctact        60
     cctgctcctc ctatagggcc tgcactaggt caaagaaaag ttaatatagc agcattttgt       120
     aaagatttta atgatgctac gaacggtatg gagaaaggag tacctttacc tactgtaatt       180
     acagtttatg acgataatag tttttctttt aaagttaaaa ctccacctgc ttcatatttt       240
     ctaaaaaagt atgctaaaat tactaaaggt tctagcgcta ctaaaaaaga agctatggtt       300
     ggtaaagtga ctctagatgc ttgtcgtgaa attgcaaagt taaaaatatc tgatttaaat       360
     acaaaaaata ttgaagcagc aaccaagatt atttgtggta gtgctgcatc tatgggactt       420
     gaagtagtag ggaattaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page