(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPLO

AE017197.RPLO        Location/Qualifiers
FT   CDS_pept        complement(819219..819671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="RT0632"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:RT0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04095"
FT                   /db_xref="GOA:Q68W97"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W97"
FT                   /protein_id="AAU04095.1"
FT                   /translation="MKLNELYNNIGAKKNKKRIARGIGSGKGKTAGRGIKGQKSRSGVA
FT                   IKGFEGGQTPMIKRLPKRGFKCISTKKYNIINIYNIEKALTDGRLSTNNIITKEKLIEI
FT                   GLINNKNLVKLLSICSDDFASPLSLKLDAYSSKAKYLIEKAGGQLL"
     atgaaattaa atgaattata taataatata ggtgctaaaa aaaataagaa aagaatagca        60
     cgcggtattg gtagtggtaa aggtaaaact gctggtagag gaattaaagg tcaaaaatct       120
     agatctggtg ttgcaataaa aggttttgaa ggtggtcaaa cacctatgat taaaaggtta       180
     cctaaaagag gatttaagtg tatttcaact aaaaaatata atataataaa tatttacaat       240
     attgaaaaag cattgaccga tggtcgttta agtactaata atattattac taaagaaaag       300
     ttaatagaaa ttggtttaat taataataaa aatttagtaa agttattatc tatttgtagt       360
     gatgattttg cttctccttt atcattaaaa ttagatgctt attcttctaa agcgaagtat       420
     ttaattgaga aagcaggtgg acaattatta taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page