(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPLQ

AE017197.RPLQ        Location/Qualifiers
FT   CDS_pept        complement(814945..815358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="RT0626"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:RT0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04089"
FT                   /db_xref="GOA:Q68WA3"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WA3"
FT                   /protein_id="AAU04089.1"
FT                   /translation="MRHRIKGRRLNVTSSHRQSMLANMAVALVMHEQIKTTLPKAKELR
FT                   PYIEAIITKAKKADLTVRRSVLSKIKDKKAVEKIINILGVRYKDRPGGYTRIVKSGFRY
FT                   GDLAPIAYIEFVDRDINAKGKKMYQDASEEIKN"
     atgcgacata gaattaaagg tagaaggtta aatgtaacga gtagtcatag gcaatcaatg        60
     cttgctaata tggctgtggc acttgtaatg catgagcaaa ttaaaactac tctaccaaaa       120
     gctaaggaat taagacctta cattgaagct ataattacta aagctaaaaa agctgattta       180
     acagtgagaa gaagcgtttt atcaaaaata aaagataaaa aagcagtaga aaagattata       240
     aatattttag gtgtccgata taaagataga cctggaggtt atactagaat agtaaagtct       300
     ggattccgtt atggtgattt agcaccgata gcgtatattg aatttgtaga tagagatatt       360
     aatgctaaag gtaaaaaaat gtatcaggat gctagtgaag aaattaaaaa ttaa             414
//

If you have problems or comments...

PBIL Back to PBIL home page