(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPLW

AE017197.RPLW        Location/Qualifiers
FT   CDS_pept        complement(826421..826717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="RT0649"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:RT0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04112"
FT                   /db_xref="GOA:Q68W80"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W80"
FT                   /protein_id="AAU04112.1"
FT                   /translation="MSVYKYYDLIKKPIITEKTTSISEQNKYTFYVNKFAKKLTIKKAI
FT                   EAIFKVKVKKVNILNIQGKKKRFKGIIGTQINQKKAIVTLEKDHNIDYAGGIK"
     atgagtgtat ataaatacta cgatttaatt aaaaaaccta ttattacaga aaaaactaca        60
     agtatttctg agcaaaataa atatactttt tatgtaaata agtttgctaa aaaattgacc       120
     attaaaaagg ctatagaagc aatatttaaa gtaaaagtaa aaaaagtaaa tattttaaat       180
     attcagggta agaaaaaaag atttaaagga attataggga ctcaaatcaa tcaaaaaaaa       240
     gctattgtta cattagaaaa agaccataat atagattatg ctggaggaat taaataa          297
//

If you have problems or comments...

PBIL Back to PBIL home page