(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPLY

AE017197.RPLY        Location/Qualifiers
FT   CDS_pept        complement(772293..772904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplY"
FT                   /locus_tag="RT0594"
FT                   /product="50S ribosomal protein L25"
FT                   /db_xref="EnsemblGenomes-Gn:RT0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04059"
FT                   /db_xref="GOA:Q68WD3"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WD3"
FT                   /protein_id="AAU04059.1"
FT                   /translation="MSEILELEAKSRTEFGTGAARALRREGRVPAIIYGAGKIPISISL
FT                   EEKEITKYYRRPAFISQLINLTIDKKQYKVLPKAVELHPVTDIVRHVDFVFLEAKTQKM
FT                   EVPVVYEGKERALGVKRGGYFNIIKRRVILLCDINNIPRNVTIDVTNMPIGTSLKSSEV
FT                   KLPIGCSFVTKKEFVLATIIGRKGVKTEIEGEQQVAGAMQ"
     atgagtgaaa tattagaact tgaagctaaa tctcgtacgg aattcggtac tggtgcagca        60
     agagcgttaa gaagagaagg tcgtgttcct gctattattt atggtgcagg taaaatacct       120
     attagtattt ctttggaaga aaaggaaata actaaatatt atagaaggcc ggcttttatc       180
     tctcagttaa ttaatttaac aattgataag aaacaatata aagtattacc aaaagccgtg       240
     gaattacatc cagttactga tatagtacgt catgttgatt ttgtcttttt agaagccaaa       300
     acacaaaaaa tggaagtacc tgtagtatat gaaggaaaag aaagagcttt aggtgttaaa       360
     agaggtggat attttaatat aataaaaaga agagtaattt tattatgtga tattaataat       420
     ataccaagaa acgtaactat agatgttacc aatatgccta ttggtacttc gctaaaatcg       480
     tcggaagtaa aattgcctat aggatgtagt tttgtgacaa aaaaagaatt tgtacttgca       540
     actattatcg gacgtaaagg agtaaaaact gaaattgaag gagaacaaca agttgctgga       600
     gcaatgcagt aa                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page