(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPMB

AE017197.RPMB        Location/Qualifiers
FT   CDS_pept        complement(49441..49734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="RT0038"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:RT0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03525"
FT                   /db_xref="GOA:Q68XW7"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XW7"
FT                   /protein_id="AAU03525.1"
FT                   /translation="MSRKCELTGVSVLYGNNVSHSQRKTRRRFEPNLRSVKFRSDITDE
FT                   VYRLSVNARCIRSVEKAGGFDEYILKANNDVLSSTARAIKQKIIDIKAVESL"
     atgtctcgta aatgtgagct cacaggtgtt agtgttttat atggtaataa tgtatcacat        60
     tctcaacgta aaactagaag acgttttgaa cctaacttaa ggtctgttaa gtttagaagt       120
     gatataacag acgaggtata tagattatct gttaatgcta gatgtattag atcagtagaa       180
     aaagctggag gttttgatga atatattcta aaagctaata atgatgtttt atctagtacg       240
     gctagagcta ttaagcaaaa aatcattgat atcaaagcgg tggaatcatt atga             294
//

If you have problems or comments...

PBIL Back to PBIL home page