(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPMH

AE017197.RPMH        Location/Qualifiers
FT   CDS_pept        774692..774826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="RT0598"
FT                   /product="50S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:RT0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04063"
FT                   /db_xref="GOA:Q68WC9"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WC9"
FT                   /protein_id="AAU04063.1"
FT                   /translation="MKRTFQPSNLVRKRRHGFRSRMITVTGRAILKKRRAKGRHKLSA"
     atgaaacgta catttcaacc tagtaattta gttagaaaaa gaagacatgg ttttagatct        60
     agaatgatta ctgtaactgg aagggcaatc ttaaaaaaac gtcgtgctaa aggtagacat       120
     aaattatctg cttaa                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page