(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPMI

AE017197.RPMI        Location/Qualifiers
FT   CDS_pept        773991..774197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="RT0596"
FT                   /product="50S ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:RT0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04061"
FT                   /db_xref="GOA:Q68WD1"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WD1"
FT                   /protein_id="AAU04061.1"
FT                   /translation="MPKLKTKSAVKKRFKFTATGKVIASQAGKKHFMRRRTKAQIRNLR
FT                   GTTILCPQDGYNIKKYFLPYGIN"
     atgcctaaat taaaaacaaa gtctgccgta aaaaaacgtt ttaaatttac tgctacaggc        60
     aaggttattg catctcaagc aggtaaaaaa cattttatgc gtcgtcgcac taaagctcaa       120
     attcgtaatc ttagaggcac tacaatactt tgtcctcaag acgggtataa tattaaaaaa       180
     tattttttac cgtacggtat aaattaa                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page