(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPSE

AE017197.RPSE        Location/Qualifiers
FT   CDS_pept        complement(819914..820441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="RT0634"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:RT0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04097"
FT                   /db_xref="GOA:Q68W95"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W95"
FT                   /protein_id="AAU04097.1"
FT                   /translation="MSKVKKNEEALSEVLVDVNRVTKVVKGGRRFAFSAYVVVGDKAGR
FT                   VGAGHGKAKEVNEARGKAKQAAKKRMMKVPLYQNRTIHHDVVGKSGAAKVILRRAKAGT
FT                   GVIAGGSMRAIFDSLGVHDIVAKSIGSTNVYAMISATFDALNKLASPKSIAIRRGKKVH
FT                   EISVKSYIQVNK"
     atgtctaaag ttaaaaaaaa tgaagaggct ttaagcgagg ttttagttga tgtcaataga        60
     gttaccaagg tagtaaaagg tggtagaaga ttcgcttttt ctgcttatgt agttgttggt       120
     gataaagctg gaagagtagg agctggacac gggaaagcta aagaagtaaa tgaagctcga       180
     ggaaaggcaa aacaagctgc taaaaagcga atgatgaaag tcccattata tcaaaatagg       240
     actattcatc atgatgttgt tggtaaaagt ggagctgcta aagtaatttt aagaagagct       300
     aaagcaggta caggcgttat agctggcggg tctatgagag caatttttga ttctttaggt       360
     gtacatgata ttgttgctaa atcaataggt tcaactaatg tttatgcaat gatttctgca       420
     acatttgatg cattaaataa gcttgcctca ccaaaatcta ttgctataag aagaggtaaa       480
     aaagtacatg aaatatctgt caaatcttat attcaagtta ataaataa                    528
//

If you have problems or comments...

PBIL Back to PBIL home page