(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPSG

AE017197.RPSG        Location/Qualifiers
FT   CDS_pept        154152..154634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="RT0120"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:RT0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03606"
FT                   /db_xref="GOA:Q68XN6"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XN6"
FT                   /protein_id="AAU03606.1"
FT                   /translation="MSRRHVAEKRIILPDMKYNSILLSRFINNIMKAGKKAVAEKIVYS
FT                   AFNKIEKKHSVDPYQTFNNAMHNVKPHLEVTSVRVGGANYQVPTHVDERRGYALASRWI
FT                   INAASKRSEKMMIDKLAEELFEAANNRGVAIKKKEDIHKMAEANKAFSHFSPKKMK"
     atgtcacgtc gtcatgttgc agaaaagcgg ataattttac ctgatatgaa atataacagt        60
     attttactat caaggtttat caataatatt atgaaagcag ggaagaaagc tgttgcagag       120
     aaaattgttt attcagcctt taataaaatt gaaaaaaaac atagtgttga tccgtatcaa       180
     acctttaata atgctatgca taatgtaaaa ccacatttag aagtaacttc agttagggtt       240
     ggaggagcta attatcaagt tccgactcat gttgatgaaa ggagaggata cgcgcttgct       300
     agccgttgga ttattaatgc tgcatcaaag cgttctgaaa aaatgatgat tgataaactt       360
     gctgaagagt tgtttgaagc tgctaataat agaggtgtcg cgattaagaa gaaagaagat       420
     attcataaaa tggctgaggc taataaagct ttttctcatt ttagccctaa aaaaatgaaa       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page