(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPSH

AE017197.RPSH        Location/Qualifiers
FT   CDS_pept        complement(821372..821770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="RT0637"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:RT0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04100"
FT                   /db_xref="GOA:Q68W92"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W92"
FT                   /protein_id="AAU04100.1"
FT                   /translation="MSMTDNVADMLTRIRNAYKSKLINVSFPSSKIKNSILDVLQKEGY
FT                   IKDYVITQKNNISYTKVALKYSINGEASICEIRRVSKPGKRVYSAIKDLKGYYNNMGIY
FT                   ILSTPYGVMSDREAHIKNVGGEVICKVF"
     atgtcaatga ctgataatgt agcagatatg ttaactagaa ttagaaatgc ttataaaagt        60
     aaattaataa atgtttcgtt tccaagttct aaaattaaaa attcgatttt agatgtgttg       120
     caaaaagaag gttatataaa agattatgtg atcactcaaa aaaataatat cagttatact       180
     aaggtggctt taaaatactc tataaatggt gaggcttcta tatgcgaaat tcgtagagtg       240
     tcaaagcctg gaaaaagggt atattctgct attaaagatt tgaaaggata ttataataat       300
     atgggaatat atattctttc tactccttac ggtgttatgt ctgatagaga agctcatatt       360
     aaaaatgttg gtggtgaagt aatttgtaaa gtattttaa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page