(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPSK

AE017197.RPSK        Location/Qualifiers
FT   CDS_pept        complement(816412..816795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="RT0628"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:RT0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04091"
FT                   /db_xref="GOA:Q68WA1"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WA1"
FT                   /protein_id="AAU04091.1"
FT                   /translation="MNQTIKVKKKKKTITLGVVHIRASFNNTIVTFTDIQGNTISSASA
FT                   GGNGFKGARKATPYAAQVTIDKASEKAKECGLKTISIRIGGPGAQRESAMRALFGQNFV
FT                   VTSILDVSSIAHNGVRPPKRRRV"
     atgaatcaga ctattaaagt taaaaaaaag aaaaaaacta ttactcttgg tgttgtacat        60
     atccgagcgt catttaataa tactatagta acatttactg atatccaagg taatactatt       120
     tcttctgcat cagcaggtgg caatggtttt aagggggcaa gaaaggcaac tccttatgca       180
     gctcaagtca caattgataa agcatctgaa aaagcaaaag aatgtggttt aaaaactatt       240
     tctattagga ttggcggtcc tggagcacag cgagaatcag caatgcgtgc tttatttggg       300
     caaaattttg tagttacatc aattttagat gtatcgtcta ttgctcataa tggagtaaga       360
     ccgccaaaaa gaagaagagt ataa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page