(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPSN

AE017197.RPSN        Location/Qualifiers
FT   CDS_pept        complement(821789..822094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="RT0638"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:RT0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04101"
FT                   /db_xref="GOA:Q68W91"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W91"
FT                   /protein_id="AAU04101.1"
FT                   /translation="MAKVSAIQKNKSRQKKSQRLHNKRSALKSKIYDKSLSLEQRFSLI
FT                   IALAQLPRNSSSTRIRNRCELTGRPRGVTRKFGISRNKLRELIGRGLVPGVVKASW"
     atggcaaaag taagtgctat acaaaagaac aaaagtaggc aaaaaaaatc acaacgttta        60
     cataataaac gttcagcact aaaaagtaaa atttatgata aaagtctctc attagaacaa       120
     cgtttttctt tgataattgc acttgcacaa ttacctagaa attcatcatc tactagaata       180
     cgaaatagat gtgagcttac aggtagacca aggggtgtta caagaaaatt tggtatatca       240
     aggaataagc ttagggaatt aattggtaga ggtttagtcc ctggtgtagt taaagcaagt       300
     tggtaa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page