(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPSQ

AE017197.RPSQ        Location/Qualifiers
FT   CDS_pept        complement(823405..823653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="RT0642"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:RT0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04105"
FT                   /db_xref="GOA:Q68W87"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W87"
FT                   /protein_id="AAU04105.1"
FT                   /translation="MRNIKMPKRVLQGVVISSKTDKTVTVKVERKFKHPIYKKFVKVSK
FT                   KYAAHDIENKYREGDKVSIVESRPISKTKTWVVVNVE"
     gtgaggaata ttaaaatgcc gaaaagagtg ttacaaggcg tggttataag ttcaaaaact        60
     gataagacag ttacagtaaa agtagaaaga aagtttaagc atcctattta taaaaaattt       120
     gtgaaagtat ctaaaaaata tgctgctcat gatatagaaa ataaatatag agaaggagat       180
     aaagttagta tagttgaaag ccgtcctatc tcaaaaacaa aaacatgggt agtagtaaat       240
     gtggaataa                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page