(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPSR

AE017197.RPSR        Location/Qualifiers
FT   CDS_pept        complement(116866..117153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="RT0090"
FT                   /product="30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:RT0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03576"
FT                   /db_xref="GOA:Q68XR6"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XR6"
FT                   /protein_id="AAU03576.1"
FT                   /translation="MLKSNNASKTATCKVGDKAAKKVFFRRRKGCPLSVPNAPVIDYKN
FT                   PELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILALLPFVFQAK"
     atgttaaaaa gtaataatgc tagtaaaaca gctacttgca aggtaggaga taaagctgct        60
     aaaaaagtat tttttagaag acgtaaagga tgtcctcttt ctgtacctaa tgcacctgtt       120
     attgactata aaaatcctga acttttaata aaatttgtat ctgaaggtgg tagaatgcta       180
     ccaagtagga tcacaaatgt ttgtgcaaag aaacaaagaa aactaaataa tgctattaaa       240
     attgcaagga ttttagcgtt attacctttt gtatttcaag ctaaataa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page