(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPST

AE017197.RPST        Location/Qualifiers
FT   CDS_pept        complement(814653..814925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="RT0625"
FT                   /product="30S ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:RT0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04088"
FT                   /db_xref="GOA:Q68WA4"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WA4"
FT                   /protein_id="AAU04088.1"
FT                   /translation="MANHSSAKKVVRQTIKRTLINKKRSSAIKTFIKKVMYEISRGNKE
FT                   DANLALSVAQSKIMQGVKKNIIKLNTASRKISRLSRQIKNLHKSE"
     atggctaatc attcttcagc aaaaaaagtt gttagacaaa caataaaaag aacgctaatt        60
     aataaaaaaa gatctagtgc aataaaaact tttataaaaa aagttatgta tgagatcagt       120
     cgtggtaata aagaagatgc caatctagct ttatctgttg cgcagtctaa gataatgcaa       180
     ggtgtaaaaa aaaatataat taaattaaat actgcttcaa gaaaaattag tagattatca       240
     agacaaataa aaaatttgca caaaagtgaa taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page