(data stored in SCRATCH3701 zone)

EMBL: AE017197.SCA4

AE017197.SCA4        Location/Qualifiers
FT   CDS_pept        complement(618161..621220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sca4"
FT                   /locus_tag="RT0485"
FT                   /product="cell surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:RT0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03957"
FT                   /db_xref="GOA:Q9AJ63"
FT                   /db_xref="InterPro:IPR020954"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AJ63"
FT                   /protein_id="AAU03957.1"
FT                   /translation="MSKNDNQDISEFDPLNREFTEAEKQQQMQQEQEFFSQSILDIVDD
FT                   GFIVASSSQSTPSISVLSNSLPHGDQKSDPITEAIRKEILEKQRDILREYLANTNPELA
FT                   AQIAKEEDDKKFRAFLSNQDNYALINKAFEDPETKKNLEEVEIVGYRNILSTYSAASGY
FT                   PGGFQPVQWENQVSASDLRSTVVKNDAGEELCTLNETTIKTNSLIVAKQDGTQVQINSY
FT                   REIDFPIKLDKADGSMHLSMVALKADGTKPAKDKAVYFTAHYEEGPNGKPQLKEISSPQ
FT                   PLKFVGTGDDAVAYIEHGGEIYTLAVTRGKYKAMMKEVALNNGQSVDLSQTIAEDLTKV
FT                   QGPSHVRHTPIITPNQELELSIETHSNQQVPPITTFNKPLQPEISQTHQLQPQQAQSSG
FT                   IPNLVLNAAHALSISMQDLLHNINASLTQKQDINKQSDLIKEAANTILNNKKSDFAEKQ
FT                   YNIIALTENTLSNKDIIADAKVNVVSALLETIQNDQNTLDIQKSKILEATVAITLNSEN
FT                   IELKQKQQILEKVVDVSLSIKDDISRAVAIDSITDAVIKSNIANKDKEQIFMTIFDQVN
FT                   SYEFSNITKQKLLGSMLKKAVETKVISPEQQQLIHQNLDKITTEHTKRDTIEKVNNILL
FT                   DPFSNTVLKTTNIQVITANVLDSPVPVEIKSELIQVVTQKVAESALEPKDKTEIVKGIG
FT                   KIIATHSDTSLPLYDKGVIMESVAKGIVESKTDLRERELITEGLVNGIYEVKGDKAVVH
FT                   AISSVIANSNINQSEKEVLKKSQDIVSERVLDKEIQNLDGELKEKNIEESKLRDDIYNK
FT                   TQDVANELNIKTFLDDNHGKREVSEEVPKNTSSLLNDISQRTIEKVNNLRAMLSQDANL
FT                   KTFEEKKDESTKKVDELVKAFDNKSSTEEQQNFIKSHLIDNKTLSREVRLQIIDNLLKA
FT                   QAQKRAETIENLSAKTEDVRVVSGKSELEPISKDEPYIQKAKMVVERDRVGIKDNIKIM
FT                   GALINARDSIQSENLNKSTHIKKESSVPQR"
     atgagtaaaa acgataacca agatataagt gaatttgatc ctttaaatag agaatttacg        60
     gaagcagaaa aacaacaaca aatgcaacaa gaacaagaat ttttttctca atctatacta       120
     gatatagttg atgatggttt tatagttgca tcttcttctc aatctacacc ttcaattagt       180
     gttttatcaa acagtctccc acatggtgat cagaaatcag atccaataac tgaagctata       240
     agaaaagaaa tccttgaaaa acaaagagat atattaaggg aatatttggc taatacaaat       300
     ccagaactcg ctgcacaaat agcaaaagaa gaagacgata aaaaattccg tgcttttttg       360
     agtaatcaag ataattatgc tttaattaat aaagcttttg aagatccgga gacgaaaaag       420
     aacctagaag aagttgaaat agtcggttat agaaatattc tctctacata tagtgctgcg       480
     agtggatatc caggtggatt ccaaccagta cagtgggaaa atcaagttag tgcaagtgat       540
     cttagatcta cggtagttaa aaatgatgca ggtgaagaat tatgtacctt aaatgaaaca       600
     actattaaaa ctaattctct gattgtagcc aaacaagatg gtactcaggt tcaaatcaac       660
     tcatatagag agatagattt tcctataaaa cttgataaag ccgatgggtc aatgcattta       720
     tctatggtag cattaaaagc tgatggtaca aaaccagcta aagataaagc agtatatttt       780
     actgcacact atgaagaagg gccaaatggt aaaccacaac ttaaagaaat cagttcacca       840
     caacctttaa aatttgtagg cactggtgat gatgcagtag cttatattga gcatggtgga       900
     gaaatttata cgcttgcagt tacacgtggt aagtataaag caatgatgaa agaggtagca       960
     ctaaacaatg ggcagagcgt tgacttatca caaactatag ctgaagattt aacaaaggta      1020
     caaggtccat ctcatgtgag acatacacca ataataactc caaatcaaga attagaatta      1080
     tctattgaaa cacattctaa tcaacaagtg ccaccaatca ctacgttcaa taaaccacta      1140
     caacctgaaa tttcacaaac acatcaattg caaccacaac aagctcaatc ttcaggaatt      1200
     ccaaatctag tactgaatgc agctcatgct ttatcaataa gtatgcaaga tttgttacat      1260
     aatataaatg catctttaac acaaaaacaa gacatcaata agcaaagcga tttaattaag      1320
     gaagcagcta acacaattct taataataag aaaagtgatt ttgctgaaaa gcagtataat      1380
     ataattgctt taactgaaaa tacactctct aataaagaca ttatagcaga cgctaaagta      1440
     aatgtagtca gtgcattatt agaaactata caaaatgatc agaatacact agacatacaa      1500
     aaatcaaaaa tacttgaagc tacagtagct attacattaa actcagagaa tatagaacta      1560
     aaacaaaaac agcaaatatt agagaaggta gtagatgtca gtttaagtat taaagatgat      1620
     ataagtagag ctgtagcaat tgatagtatt acggatgctg taataaaaag taatattgct      1680
     aataaagata aagagcaaat atttatgaca atatttgatc aagttaatag ctatgaattc      1740
     agcaatataa caaaacaaaa attgttaggt tctatgttaa agaaagctgt agaaacaaaa      1800
     gttattagtc cggaacaaca gcaattgatc catcagaatt tagataagat tacgacagaa      1860
     cacactaaaa gagatacaat agaaaaagta aataatattt tactggatcc tttcagtaat      1920
     actgtattaa aaacaacaaa tatacaagtt attacagcta atgttctaga tagtccagtt      1980
     ccagtagaga taaaaagtga attaattcaa gtagttactc aaaaagtggc agaaagtgca      2040
     cttgaaccta aagacaaaac agagattgtt aaaggtatag gcaagattat agcgactcat      2100
     agtgatactt ctttaccttt atatgataaa ggagtgatta tggagtcagt ggcaaaaggt      2160
     attgtcgaaa gtaagactga tttacgtgag agagagctaa tcactgaagg gttagtaaat      2220
     ggaatttatg aagtaaaagg agacaaggca gttgttcatg caatttctag tgtgatagct      2280
     aatagtaata ttaatcaatc tgagaaagaa gtacttaaaa aatctcaaga tatagtaagt      2340
     gagagagttt tagataaaga aatacaaaat ttagatggag agttaaaaga gaaaaatata      2400
     gaagaatcta aacttcgtga tgatatatat aacaaaacgc aagatgttgc taatgaatta      2460
     aatattaaaa cttttttaga tgataaccac ggaaaacgtg aagtctcaga agaagtacca      2520
     aaaaacactt ctagcctatt aaatgatatc tctcagcgta caattgagaa agtcaataat      2580
     ttgcgagcta tgctctctca agatgctaat cttaaaactt ttgaagaaaa aaaagatgaa      2640
     tcaacaaaaa aagtagatga gctagtaaag gcatttgata ataaatcttc tactgaagaa      2700
     cagcaaaatt tcattaaatc tcatttaatt gataataaaa ctttatctag agaagtacgt      2760
     ttacaaatta tagataattt attaaaagca caggcacaaa aacgagcaga aacaattgaa      2820
     aaccttagtg ctaaaacgga agatgtaaga gtagtatcag gaaagtctga attagaacct      2880
     ataagtaaag acgaaccata tattcaaaaa gctaaaatgg tagtagaaag agatagggtt      2940
     ggtattaaag acaatataaa aattatgggt gcattaataa atgcaagaga tagtattcag      3000
     tctgaaaatt taaataaatc aacacatatt aaaaaagagt cttctgttcc gcaacgctaa      3060
//

If you have problems or comments...

PBIL Back to PBIL home page