(data stored in SCRATCH3701 zone)

EMBL: AE017197.SDHC

AE017197.SDHC        Location/Qualifiers
FT   CDS_pept        149938..150312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="RT0115"
FT                   /product="succinate dehydrogenase cytochrome b-556 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RT0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03601"
FT                   /db_xref="GOA:Q68XP1"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XP1"
FT                   /protein_id="AAU03601.1"
FT                   /translation="MTKIKQEIYNKRPTSPHLTIYKPQISSTLSILHRMTGVALFFVVS
FT                   ILVWWLILSKYDNNYLQLARCCIIKICLVAFSYAWCYHLCNGIRHLFWDIGYGFSIRAV
FT                   NITGWCVVVCSILLTMLLWV"
     atgactaaaa taaaacaaga aatttataat aagcgtccta cttcgccaca tttaactata        60
     tataagccgc aaatcagttc tacactatca attttgcatc gtatgactgg cgtagcttta       120
     ttttttgtgg tatcaatttt ggtgtggtgg ttaattctaa gtaaatatga taataattat       180
     ttacagcttg ctcgttgctg tattataaaa atatgcctag tagcatttag ttatgcttgg       240
     tgttatcatt tgtgtaatgg aattcgtcat ttattttggg atattggtta cggtttttct       300
     ataagagcag taaatatcac aggttggtgt gtggtagtat gttctatatt attaactatg       360
     ttattatggg tatga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page