(data stored in SCRATCH3701 zone)

EMBL: AE017197.SDHD

AE017197.SDHD        Location/Qualifiers
FT   CDS_pept        150470..150847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="RT0116"
FT                   /product="succinate dehydrogenase hydrophobic membrane
FT                   anchor protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03602"
FT                   /db_xref="GOA:Q68XP0"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XP0"
FT                   /protein_id="AAU03602.1"
FT                   /translation="MIYDFKAEIIKSKSSSSSKSGAHHWLLQRVTGVVLALCSFWLIYF
FT                   MFTNKNNDINIIMWEFKKPFNIVILLITVTISLYHSVLGMRVVIEDYINCHKLRNTLII
FT                   IVKLFCILTIVAFIVAIFYSE"
     atgatatatg attttaaggc agaaattata aaatctaaaa gtagcagttc ttctaaaagt        60
     ggtgcgcatc attggttatt gcaaagagta actggtgtgg tattagcttt atgttctttt       120
     tggttaatat attttatgtt taccaacaaa aataatgata taaatattat tatgtgggag       180
     tttaaaaaac cttttaatat agtaatttta ttaattacgg ttactatttc attgtatcat       240
     tcagtacttg ggatgcgtgt agtaattgag gactatataa attgtcacaa attacgtaat       300
     acattgatta taatagtgaa attattttgt attttgacta ttgtagcttt tatagtagcg       360
     atattttata gtgaataa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page