(data stored in SCRATCH3701 zone)

EMBL: AE017197.SECA

AE017197.SECA        Location/Qualifiers
FT   CDS_pept        complement(729876..732593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="RT0564"
FT                   /product="preprotein translocase SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RT0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04031"
FT                   /db_xref="GOA:Q6TUJ8"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6TUJ8"
FT                   /protein_id="AAU04031.1"
FT                   /translation="MFSILKKLFGTANDRTVKKLFSEITKINSLEPAIKILSDAALKNK
FT                   TVEFKEKLKNGATLDDILYEAFAVVREAASRVCGMRHFDVQLIGGLILHRGMIAEMRTG
FT                   EGKTLVATLPAYLNALTGKGVHVVTVNDYLAIRDSASMGKIYNFLGLSVGCIVAGMTDE
FT                   AKRIAYNSDITHATNNELGFDYLRDNMKYSMQERVLRPFNFAIIDEVDSILIDEARTPI
FT                   VISGPVNDNSALYGKIDKIIRLLNDSDFEKDEKLKTINLTEVGITNIESLLIKDGIIKP
FT                   DTGLYDFENLNLVHYVNQALRAHHMFTVDVDYLVREGKVMIIDEFTGRVMEGRRYSEGL
FT                   HQALEAKENVKIQNENQTLASITFQNYFRNYHKLSGMTGTSMTEASELKDIYNLDVVAV
FT                   PTHNKVTRIDLDDEIYGSKQEKYDAILKLIRDCYNRGQPILVGTISIEKSEELSSILNK
FT                   EKIPHNVLNAKFHEQEAFIIAQAGRFKAVTIATNMAGRGTDIMLGGNPEMLIEQLNKDR
FT                   NYVAKTAEIKAQIAEEKQKVIETGGLFVIGTERHESRRIDNQLRGRSGRQGDPGKTQFF
FT                   LSLDDDLMRIFASDRISGVLRTLGLKNGEAIHHPMISRSLEKAQQKVEAHNYEMRKNLL
FT                   RFDDVMNDQRKIIYEQRTEIIKSKDSYGFLNSTTEELARKIVLTFMPLGSYREDWDIDN
FT                   LTVELHRIFSIKFDHNLVHKNDVTEEDITKLVIQMAHDIYKSKEEAYSSELMNNAVKYI
FT                   LLTTLDQVWKDHLYSLDHLRQGISLRAYAQKDPLSEYKREAFNLFEQMLNNLKELFIQT
FT                   VYHFHIDLRHLQKEDISLEHKKLQKNMCESREDPAFSKYNAGNSIETYLKPVVLRVDPK
FT                   DRKPDDPMSWGRVSRNELCPCGSGKKYKYCHGAN"
     atgttttcta ttttaaaaaa actttttggg actgctaatg atcgtactgt aaaaaaacta        60
     ttttctgaaa ttacaaagat taactcactt gagcctgcaa taaagatatt atcagatgcg       120
     gcgttgaaga ataaaactgt agagtttaaa gaaaaactta aaaacggagc tactttagat       180
     gatatcttat atgaagcgtt tgcagtagtg agagaagcgg ctagcagagt ttgtggtatg       240
     cgacattttg acgttcagct tataggtggt cttatattac atcgtggtat gattgcagaa       300
     atgcgtactg gtgagggtaa aacattagtt gcaacgcttc ctgcatattt aaatgcttta       360
     actggaaaag gtgtacatgt tgtaactgtg aatgattatt tagcaattcg tgattctgct       420
     tctatgggta aaatttataa ttttttagga ttatcggttg gatgtattgt tgcaggtatg       480
     actgatgaag caaaacggat tgcatataat tccgatatta ctcatgcaac aaataatgaa       540
     cttggttttg actatttaag ggataatatg aagtatagta tgcaagagcg cgtactgcgt       600
     ccttttaatt ttgctattat tgatgaagtt gattcgattt tgatagatga agcaagaacc       660
     ccaatagtga tctcgggtcc agttaacgat aattcagcat tatacggtaa aattgataaa       720
     attatacgtt tgcttaatga cagtgatttt gaaaaagatg aaaaactaaa aactattaac       780
     ttaacagaag taggtattac aaatatagaa tcgctgttaa ttaaagatgg tattataaaa       840
     cctgatactg gtttatatga ttttgagaat ttaaatttag tacattatgt taatcaagca       900
     ttaagagctc atcatatgtt tactgttgat gttgattatt tggtgcgtga aggtaaagta       960
     atgattatag atgaatttac tggacgtgta atggagggac gtagatattc agaaggcttg      1020
     caccaagcat tagaggcaaa agaaaatgta aaaattcaaa atgagaacca aactttggca      1080
     tctattacat ttcaaaatta ctttcgtaat tatcataaat tatctggtat gactggtaca      1140
     tctatgactg aagcatcaga attaaaagat atatataatt tggatgttgt tgcagttcca      1200
     acacataata aagttacaag gattgacctt gatgatgaaa tttacggaag taaacaagaa      1260
     aaatatgatg ctatcttaaa gttgattagg gattgttaca atcgtggtca gcctatactt      1320
     gttggtacca taagtattga aaagtcagaa gaattgtcaa gtattttaaa taaagaaaaa      1380
     atacctcata acgtattaaa tgctaaattt catgagcaag aagctttcat tattgctcaa      1440
     gcaggtaggt ttaaagccgt aacgattgca accaatatgg cagggcgagg cactgatatt      1500
     atgcttggcg gcaatcctga aatgttaata gaacagctta ataaagatcg taattatgta      1560
     gctaaaacag ctgaaattaa agctcaaatt gctgaagaaa agcagaaggt tattgaaaca      1620
     ggtggcttat ttgtaatagg tacagaaagg catgaaagcc gtaggataga taatcagtta      1680
     agaggaagat caggaagaca aggcgatcct ggtaaaaccc aatttttttt atcacttgat      1740
     gatgatttaa tgcgtatttt tgcatcagat cgtatatcag gagttcttag aacacttggc      1800
     ttaaaaaacg gagaagctat tcaccatccg atgattagtc gttcacttga gaaagctcag      1860
     caaaaagtgg aagcacataa ctacgagatg cgtaaaaatt tattacgttt tgatgatgta      1920
     atgaatgatc aacgtaagat aatatatgag caacgtactg aaattattaa atctaaagat      1980
     agttacggtt tcttaaatag tactactgag gaactcgcta gaaagatagt attaactttt      2040
     atgccgttag gctcttatag agaagattgg gatatagaca atttaactgt agaattacat      2100
     cgtatctttt ctataaaatt tgatcataat ttagtgcata aaaatgatgt gacagaagaa      2160
     gatatcacga agcttgttat acaaatggct catgatatat ataagtcaaa agaagaagca      2220
     tatagtagtg agttaatgaa taatgcggta aaatatattt tactaactac tcttgatcaa      2280
     gtgtggaaag atcatttata tagcttagat catttaaggc aaggtatctc acttcgagct      2340
     tatgcacaaa aagatcctct gagtgagtat aaaagagaag catttaattt atttgagcaa      2400
     atgcttaata atttaaaaga attatttatt caaactgtat atcacttcca tatcgactta      2460
     agacatcttc aaaaagaaga tatttcactt gaacataaaa aacttcaaaa aaatatgtgt      2520
     gagagtcggg aagatccagc ttttagtaaa tataatgctg gaaatagtat tgaaacttat      2580
     cttaaaccgg tcgtgttacg cgttgaccca aaagatagaa aacctgatga tcctatgagt      2640
     tggggtagag tatcacgtaa tgagctgtgt ccgtgtggtt caggtaagaa atataaatat      2700
     tgtcatggtg caaattaa                                                    2718
//

If you have problems or comments...

PBIL Back to PBIL home page