(data stored in SCRATCH3701 zone)

EMBL: AE017197.SECB

AE017197.SECB        Location/Qualifiers
FT   CDS_pept        complement(80782..81240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="RT0062"
FT                   /product="protein-export protein SecB"
FT                   /db_xref="EnsemblGenomes-Gn:RT0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03548"
FT                   /db_xref="GOA:Q68XU4"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XU4"
FT                   /protein_id="AAU03548.1"
FT                   /translation="MSTINSDTSEAMPHISVNAQYIKDLSLENPSAPSSLAALDQRPQI
FT                   DLSLDINITNLSDENFYEVELNIEAIARNEKYKLFQIELKYAGVFNLINIDSEQHPILL
FT                   SVHCPAMIFPFARKIIASCTQDAGFQPLMIDPIDFGALYHKKMSEHQN"
     atgagtacaa taaacagtga tactagtgag gcaatgcctc atatttccgt taatgcacaa        60
     tatataaaag atttatctct tgagaaccct tctgcaccgt cttctcttgc ggctttagat       120
     caacgtcctc aaattgattt atcgctagat ataaatatta ctaatttatc agacgaaaat       180
     ttctatgaag tagagttaaa tattgaagca attgcaagaa atgagaaata taaattattt       240
     cagatagaat taaaatatgc tggagtattt aatttaatta atattgattc tgaacaacat       300
     ccaattttat tatctgttca ttgcccagca atgatatttc catttgctag aaaaattata       360
     gctagttgta ctcaagatgc aggatttcag cctttaatga ttgatcctat cgattttgga       420
     gcattatatc ataaaaaaat gtcagagcat caaaactaa                              459
//

If you have problems or comments...

PBIL Back to PBIL home page