(data stored in SCRATCH3701 zone)

EMBL: AE017197.SECG

AE017197.SECG        Location/Qualifiers
FT   CDS_pept        complement(73210..73512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="RT0053"
FT                   /product="protein-export membrane protein SecG"
FT                   /db_xref="EnsemblGenomes-Gn:RT0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03540"
FT                   /db_xref="GOA:Q68XV2"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XV2"
FT                   /protein_id="AAU03540.1"
FT                   /translation="MLDILLFVHITISILLIIVILMQRSGSGGISGISGDNNMGVVSAK
FT                   TVGNFLSKSTIILTTLFLINAIILANLSSKKKSNLVSKINEIEENQTDNSLPIAK"
     atgttagaca tacttctttt tgtacatatt actatttcaa tactactaat tatagtgatt        60
     ctgatgcagc gtagtggttc tggtggaatt agtggtataa gcggtgataa caatatgggt       120
     gtagtaagtg ctaaaacagt tggtaacttt cttagcaaaa gtactataat acttacaaca       180
     ttatttttaa taaatgcaat aatacttgct aatctttctt caaaaaaaaa atctaattta       240
     gtttctaaga ttaatgaaat tgaagaaaat caaacagaca atagtttacc tatagctaaa       300
     tag                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page