(data stored in SCRATCH3701 zone)

EMBL: AE017197.SMPB

AE017197.SMPB        Location/Qualifiers
FT   CDS_pept        527994..528452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="RT0416"
FT                   /product="tmRNA-binding protein SmpB"
FT                   /db_xref="EnsemblGenomes-Gn:RT0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03893"
FT                   /db_xref="GOA:Q9AKE3"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AKE3"
FT                   /protein_id="AAU03893.1"
FT                   /translation="MTEYKKVIAQNKKAIFNYFIEEILEAGIVLKGSEVQSLRQGKASI
FT                   DESYASDNGHEVFLYNCHITEYEKANRFNHSTRRPRKLLLHTKEIKKIIGKIRIKGYTL
FT                   VALSMYFNKNNKVKVELGIAKGKKLYDKRATIKEKDWKKDQSRLIRQK"
     atgacagaat ataagaaagt tattgcacag aataagaaag caattttcaa ttattttatt        60
     gaagaaatat tagaagcagg tattgtatta aagggtagcg aagtacagtc tctacgtcaa       120
     ggtaaagctt ccatagatga aagttacgca tcagataatg gacatgaggt atttttgtat       180
     aattgccata ttacagaata tgaaaaagca aatagattta atcattctac tcgtagacca       240
     cgtaaattat tattacatac taaagagatc aagaaaatta ttggtaaaat tagaataaaa       300
     ggctatacgc tagttgcgct ttctatgtat tttaataaaa ataataaagt aaaagttgag       360
     cttggcatcg ctaaaggtaa gaagttatac gataaaagag ctacaattaa agaaaaagat       420
     tggaaaaaag atcagagcag gttaataaga cagaaataa                              459
//

If you have problems or comments...

PBIL Back to PBIL home page