(data stored in SCRATCH3701 zone)

EMBL: AE017197.SUHB

AE017197.SUHB        Location/Qualifiers
FT   CDS_pept        295407..296144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="RT0231"
FT                   /product="extragenic suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03712"
FT                   /db_xref="GOA:Q68XD0"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XD0"
FT                   /protein_id="AAU03712.1"
FT                   /translation="MQPITNLLMNAMRKAVKFLNRDFLELEMLQKNSVRNEEFCQRSYL
FT                   KLKTLLCKELQRHTQYLFFPEDIFDLNDNYESIILINPIDSTNNFCRSIPFFAISVTYL
FT                   KRNQDALTTASTVIYFPVLNEIYYAEKGKGAWIEKNNFNSNYHGLRLRVSDNADLKNCL
FT                   AIVEGLSYDNFEEIKRDNIRSFGSPCYGAALVSLGKVDLICLSLLNFTLYYAFELLIKE
FT                   AGGIIIDSSDKFICANRYLAKKL"
     atgcaaccta taactaattt attaatgaat gcgatgcgta aagcagttaa gtttttaaat        60
     agagattttt tagaactaga gatgctacag aaaaattctg taagaaatga agaattttgt       120
     caacgatctt atttaaaatt aaaaacttta ttatgtaaag aattacaaag acatacacaa       180
     tatttattct ttccagaaga tatatttgat ttaaatgata attatgagag tatcatttta       240
     attaatccta tagatagcac aaataatttt tgcaggagta tacctttttt tgctatatcc       300
     gtaacttatt taaaaaggaa tcaagatgct ttgactactg cttctactgt aatatatttt       360
     cctgttctta atgaaattta ttatgctgaa aagggtaaag gagcttggat agaaaaaaat       420
     aattttaact ctaattatca tggattaaga ctgagagtgt ctgataatgc agatttaaag       480
     aattgtttag caattgttga aggtttaagt tatgataatt ttgaagaaat aaagcgagat       540
     aatattagat cttttgggtc tccttgctat ggagctgctc ttgtatcttt aggtaaagtg       600
     gatttaatat gcttatcatt attaaatttt acattatatt atgcatttga gcttcttatt       660
     aaggaagcag gtgggataat tatagattct agcgataaat ttatatgtgc aaatcgttat       720
     cttgctaaga aactttaa                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page