(data stored in SCRATCH3701 zone)

EMBL: AE017197.TME

AE017197.TME         Location/Qualifiers
FT   CDS_pept        455946..458249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tme"
FT                   /locus_tag="RT0361"
FT                   /product="Malic enzyme"
FT                   /EC_number="1.1.1.38"
FT                   /EC_number="2.3.1.8"
FT                   /note="bifunctional"
FT                   /db_xref="EnsemblGenomes-Gn:RT0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03840"
FT                   /db_xref="GOA:Q68X02"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X02"
FT                   /protein_id="AAU03840.1"
FT                   /translation="MNEMNKINYAEALEYHEKDKPGKIAITATKSLVTQQDLSLAYSPG
FT                   VAAPCLEISKNLDAVYKYTSRSNLVAVISNGTAVLGLGNLGAAASKPVMEGKAVLFKKF
FT                   ADIDAIDLEINTEDPIEFINAVKYLSYSFGGINLEDIKAPECFLIEEKLKSLMDIPVFH
FT                   DDQHGTAIITAAGLINAAYLTNRTLEDLKIVINGAGAAAIACIDLLIALGVDKSKIILC
FT                   DTKGVIYKGRTSGMNKWKERYASDTKIRTLTESLNNADVFIGLSVKGAVTKDMISQMAH
FT                   KPIIFAMANPDPEITPEDIKFVRDDAIIATGRSDYNNQINNVMGFPYIFRGALDVRAST
FT                   INTEMKIAAARAIADLARRPVPEEVYKAYSGRKLVFGNEYIIPVPFDPRLITVVAAAVA
FT                   VAAIETGVARVKDFSIGKYKQQLGSRLNPTANYMNFLAEKIHNVPLKRIVFAEGEEEEV
FT                   ISAALMMRDEKYGNPIIIGRVERIEVILKKIGKDISLDGIQIMNAALSDRLEQYTDYLY
FT                   KRLQRKGYLYRDCAKLVKTDKNIFAACMVACGDGDALLTGVTKSYIDSLEDIMKVISPK
FT                   QNRRILGYSIMIAKDHNIIIADNCITEYPNSLELAQIATQTAEIAKNMGITPRVALISF
FT                   ATFGNSSQEKTTRIREAVNILDNFSKDKKQLNDMKVDFEYDGEMSIKVALDHDLRKLYN
FT                   FCRLSGSANVLIMPGLNSAAIATELLQKFSSNSFIGPITNGFEKPVQILQTTATANEIL
FT                   KIATFACVEAIKEV"
     atgaatgaaa tgaataaaat aaattatgct gaagcgcttg aatatcatga aaaagataaa        60
     cctggtaaaa ttgctattac tgcaacaaag tctttagtta ctcagcaaga tttatcactt       120
     gcttattctc ctggtgtagc tgctccatgc cttgaaattt ccaaaaattt agatgctgta       180
     tataaatata catctcgtag taatttagtc gcagtaatct ctaacggtac tgcagtactt       240
     ggtcttggca atttaggcgc agctgcttca aaacctgtta tggaaggtaa agctgtatta       300
     tttaaaaaat ttgctgatat tgatgcaatt gacttggaaa taaataccga agatcctata       360
     gaatttatta atgcagtaaa atatcttagt tatagtttcg gtggtattaa tcttgaagat       420
     attaaagctc cggaatgttt tcttatagaa gaaaaattaa aatctttaat ggatatacca       480
     gtattccatg acgatcagca tggcactgcg attattaccg ctgctgggct aataaatgct       540
     gcatatctta ctaaccgtac gcttgaggat ttaaaaattg taattaacgg cgcaggtgca       600
     gcagctattg cttgtattga tttattaatt gctcttggag tagataaatc aaagattatt       660
     ttatgtgata ctaaaggtgt tatttataaa ggtcgcacaa gtggtatgaa taaatggaaa       720
     gagcgttatg caagtgatac taagattagg actttaacgg aaagtttaaa taatgcagat       780
     gtttttatag ggttatcggt aaaaggtgca gtaactaaag atatgataag tcaaatggca       840
     cataaaccaa ttatttttgc tatggctaac cctgatccag aaattactcc ggaagatata       900
     aaatttgtgc gagatgatgc gattatagca acagggcgat ctgattataa taatcaaatt       960
     aacaatgtga tgggttttcc ttatattttt agaggagctt tggatgtgag agcgagtacc      1020
     attaatactg aaatgaaaat agctgcagca agagctattg cagatttagc gcgtagacct      1080
     gtaccggaag aggtgtataa agcttattca ggtcgtaaac tggtttttgg taatgaatat      1140
     attattccag taccatttga tcctcgttta attactgtag tagccgcagc ggttgctgtt      1200
     gctgcaatag aaactggcgt tgctagggtt aaagatttta gtataggtaa atataagcaa      1260
     caattaggta gtcgattaaa tcctactgct aactatatga atttcttagc tgaaaaaatt      1320
     cataatgtac cgcttaaacg gattgttttt gctgaaggag aagaagaaga agtaatttct      1380
     gctgctctga tgatgcgaga cgaaaaatat ggaaatccaa ttataattgg tcgtgttgaa      1440
     cggattgagg ttatattaaa aaagataggt aaagatatta gcttagatgg aattcaaata      1500
     atgaacgctg ctttaagtga taggctagag caatatactg attatttata taaaagactt      1560
     cagagaaaag gttatttata tcgtgattgt gccaaacttg ttaaaactga taagaatatt      1620
     tttgccgctt gtatggtagc atgtggtgat ggtgatgctc ttttaacagg tgttacaaaa      1680
     agttatatag atagtttaga agatattatg aaagtaattt ccccaaaaca aaatcgtaga      1740
     attcttggct attccattat gattgctaaa gatcataata ttattattgc cgataattgt      1800
     attacagagt atccaaacag tttagaactt gcacaaatag caacacaaac tgcagagatt      1860
     gctaaaaata tgggtatcac tcctcgtgtc gctcttattt cttttgcaac gttcggtaat      1920
     tcttctcagg aaaaaacaac tcgtattcgt gaagcagtaa atatacttga taattttagt      1980
     aaagataaaa aacagttaaa cgatatgaaa gtagattttg aatatgatgg agagatgtct      2040
     attaaggtag ctttagacca tgatttacgt aaattatata acttttgcag gttatcagga      2100
     tctgcaaatg tattaattat gccaggttta aattcagctg cgattgctac tgaattattg      2160
     caaaaatttt catcaaatag ctttataggt cctataacaa acggttttga aaaacctgtt      2220
     caaatactgc aaactacagc gacagctaat gaaatactaa aaatagctac ttttgcttgt      2280
     gttgaagcta taaaagaagt gtaa                                             2304
//

If you have problems or comments...

PBIL Back to PBIL home page