(data stored in SCRATCH3701 zone)

EMBL: AE017197.TOLB

AE017197.TOLB        Location/Qualifiers
FT   CDS_pept        371082..372413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="RT0293"
FT                   /product="TolB protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RT0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03773"
FT                   /db_xref="GOA:Q68X69"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X69"
FT                   /protein_id="AAU03773.1"
FT                   /translation="MRNIVYFILTLFSLTGYALETINIEHGRVDPTPIAVNKFNADSSN
FT                   NDLVGNAVVKVISNDLKISGLFRPISSASFIEEQTGINYKPLFAAWRQINASLLVNGEV
FT                   QTLESGKLKISFILWDTFLEKQLIGALFEVPTKLWRRAAHKIADKIYEKITGDPGYFDT
FT                   KIVYVSESTALPKIKRIALMDYDGANNKYLTNGKSLVLTPRFAHSADKIFYVSYATKSR
FT                   ALVYEKDLKTGKESVVGDFVGISFAPRFSPDGKKAVMSIAKNGSTHIYEIDLATKQLNK
FT                   LTDGFGINTSPSYSPDGKKIVYNSDKNGVPQLYIMNSDGSDVRRISFGGGSYASPSWSP
FT                   RGDYIAFTKITRHDGEKIFNIGIMKAYPQDHENSERIITSGYLVESPCWSPNGRVIMFS
FT                   KGWPSRAKAPGKNKIFTIDLTGHNEREVITPAGASDPEWSDVLN"
     gtgagaaata ttgtatattt tattctaaca ttatttagtt taaccggtta tgcacttgaa        60
     acaataaata ttgagcatgg tcgagttgat cctacaccta tagcagtaaa taaatttaat       120
     gctgatagtt ctaataatga tttagtaggt aacgctgttg ttaaagtaat ctctaatgat       180
     ttaaagattt ctggattatt ccgtcctatt tcttctgcat cttttataga agagcagaca       240
     gggatcaatt ataaaccact ttttgctgca tggcgtcaaa ttaatgctag tcttttagta       300
     aatggtgaag tgcaaacact agaaagcggt aaacttaaaa ttagctttat attatgggat       360
     acgttccttg aaaagcaact tattggtgca ctttttgaag tgccgaccaa attatggaga       420
     agagctgcac ataaaattgc tgataaaatt tatgaaaaaa tcacaggtga tcctggttat       480
     tttgatacca aaatagtata tgtatcagaa agtactgcgt taccaaaaat aaaacgaatt       540
     gctttgatgg attatgatgg tgctaacaat aaatacctta ctaatgggaa atcattagtt       600
     ttaacgccaa gatttgctca ttcagctgat aaaatttttt atgtttcata tgctactaaa       660
     agcagagcac tagtttatga aaaagattta aaaaccggta aagaaagtgt agtgggtgat       720
     tttgttggta tatcttttgc gcctagattc tcaccggacg gtaaaaaagc tgtgatgtct       780
     atagctaaaa atggctcaac tcatatttat gaaattgatc ttgctactaa acagcttaat       840
     aaattaactg atggattcgg tattaataca tcgcctagtt attcaccaga tggtaaaaaa       900
     attgtatata attcagataa aaacggtgta cctcaattat atatcatgaa ttcggatgga       960
     agtgatgtgc gacgtattag ttttggtggt ggttcttatg catctcccag ctggtcgcct      1020
     agaggcgatt atatagcatt tactaagatt actaggcacg atggagagaa aatctttaat      1080
     attggcatta tgaaagctta tccacaagat catgagaata gtgaaagaat cataacaagt      1140
     ggatatttag ttgagagtcc ttgttggtcg cctaacggac gagttattat gttttctaaa      1200
     ggttggccat ctagagctaa ggctcctgga aaaaataaaa tttttacaat tgatttgact      1260
     ggtcataatg aaagagaagt tataacaccg gcaggtgcat ctgatcctga atggtcagat      1320
     gttctgaact aa                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page