(data stored in SCRATCH3701 zone)

EMBL: AE017197.TOLC

AE017197.TOLC        Location/Qualifiers
FT   CDS_pept        278361..279725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolC"
FT                   /locus_tag="RT0216"
FT                   /product="outer membrane protein TolC precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RT0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03698"
FT                   /db_xref="GOA:Q68XE4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XE4"
FT                   /protein_id="AAU03698.1"
FT                   /translation="MSKLTTFITTLLLTGSVIAVDLEQALTEGYKNNEELKAARIKFLN
FT                   AIEQLPQAFSGFMPNVGLQINRQNSKTRYNKKYANRLGITSRDTDSTQGILTIEQSLFS
FT                   GGASIAALKAAQSGFRASRSEYYACEQKILLNLITAYLDCFESKEKYDISESRVRTNIQ
FT                   QVKTVEEKLRLGEATAIDIAAARAGLAAAETNKLAAYADFQGKKANFIKVFGIEANDIT
FT                   MPDLPDRLPTSLDEFTRKAAKLNPDINSARHNVSVAKALEMVQKGKLLPQVSVKLLSGR
FT                   TNYNPQEPVIQNINNRIYTTTLAVNIPIYPEGGAQYSRIRSAKNQTRNSVVQLDSAIKQ
FT                   IKAGVVSVWEGFETAKSRIVAANQGVEAAQISYNGIVQEEIVGSKTILDVLDAEQKLYE
FT                   AKITRVDAYKNSVLASYQMKLLAGELTAKSLKLKVKYFSPEEEFNSLKKKMFIGF"
     atgagtaaat taactacatt tattactaca ttattgctca ctggttctgt tatcgctgtt        60
     gatttggaac aagctttaac tgaaggatat aagaataatg aggagctaaa agctgctaga       120
     attaagtttt tgaacgcaat tgaacagttg cctcaagctt tctcagggtt tatgcctaat       180
     gtcggtttgc agattaatag acaaaatagt aaaactagat ataataaaaa atatgctaat       240
     aggcttggta ttacttcacg tgatacagat agcacccaag ggatattaac aattgaacaa       300
     tcattattta gtggtggggc tagtattgct gctcttaaag ctgctcaatc aggatttaga       360
     gcgtcacggt ccgaatacta tgcatgcgag caaaaaatat tattaaattt aataactgcg       420
     tatcttgatt gttttgagag taaggaaaaa tatgatatct ctgaaagtag ggtacgtact       480
     aatatacagc aagttaagac tgttgaagag aaattaagac taggtgaagc aacggcaata       540
     gatatagctg ctgcaagggc agggcttgca gcagcagaaa caaataaact agctgcttat       600
     gcagattttc aagggaaaaa agcaaatttt attaaagtgt ttggaataga ggcaaatgat       660
     ataactatgc ctgatttacc tgataggtta cctacttcgt tagatgagtt cacaagaaaa       720
     gctgctaaat taaatcctga tattaattca gcaagacata acgtatctgt tgcaaaagct       780
     ttagaaatgg tgcagaaagg aaaattatta ccgcaagtaa gtgtaaagct gctatcaggt       840
     aggacgaatt ataatccgca agagccagtt attcaaaata taaacaatag gatctatact       900
     actactcttg cagtaaatat acctatttat cctgaaggag gagcgcaata ttcaagaata       960
     agatcagcta aaaatcaaac aaggaatagt gtagtccagc ttgatagtgc aataaagcag      1020
     ataaaagcgg gcgttgttag cgtgtgggaa ggatttgaaa cagcaaaatc tcgtatcgtt      1080
     gctgctaatc aaggagtgga agctgcacaa atatcatata acggtatagt gcaagaggaa      1140
     atagttggtt ctaaaactat acttgatgtt ttagatgctg aacaaaaatt gtatgaagca      1200
     aaaataacgc gtgttgatgc ttataagaat tcagtacttg cttcatatca aatgaaatta      1260
     ttagctggtg agttaactgc taaaagttta aaacttaaag taaaatattt tagtcctgaa      1320
     gaagagttta acagtcttaa aaagaaaatg tttataggtt tctaa                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page