(data stored in SCRATCH3701 zone)

EMBL: AE017197.TOLR

AE017197.TOLR        Location/Qualifiers
FT   CDS_pept        381674..382105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolR"
FT                   /locus_tag="RT0300"
FT                   /product="TolR protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03780"
FT                   /db_xref="GOA:Q68X62"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X62"
FT                   /protein_id="AAU03780.1"
FT                   /translation="MAIKCAGSSRKSKKTVVSEINVTPLVDVMLVLLIIFMVTSPMLVS
FT                   GVNVDLPETNPSTILGQDEPLVVTINNEGKIYLLETPIERTHLTDKIINITTGNKDARI
FT                   FVRGDKNVSYGKVVEVIAEIHSAGFSRVALISNIKNNEK"
     atggctataa agtgtgctgg cagtagtaga aaaagtaaaa aaactgtagt gagtgaaatt        60
     aatgttacac cgctcgttga tgtaatgctt gtgctgttaa ttattttcat ggtaacttcc       120
     ccaatgttgg tttcaggggt aaatgttgat ttacctgaaa caaatccaag cacaatttta       180
     gggcaggatg aacctttggt tgttactatc aataatgaag gtaaaattta cctacttgaa       240
     actcctatag agagaactca tttaactgat aagattataa atattactac aggaaacaag       300
     gatgctagaa tttttgtaag aggtgataaa aacgtctctt atgggaaggt agtagaagta       360
     attgctgaaa ttcattctgc aggtttttct cgtgtagcgc ttatttcaaa tattaaaaat       420
     aatgaaaaat aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page